DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGDI and AT1G62450

DIOPT Version :9

Sequence 1:NP_001262080.1 Gene:RhoGDI / 40179 FlyBaseID:FBgn0036921 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_176435.1 Gene:AT1G62450 / 842543 AraportID:AT1G62450 Length:223 Species:Arabidopsis thaliana


Alignment Length:194 Identity:74/194 - (38%)
Similarity:106/194 - (54%) Gaps:7/194 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PEHHDDDVHDANYQAPPEKTIEEIMAADQEDESLRRYKEALLGAAQTEKIIVEPNDPRKVIVKKL 74
            |...|::..|...:..|...::|.:..|::||||||:||.|||....|.:...| ||   :||.|
plant    33 PTEDDEEDEDKKLELGPMIALKEQLERDKDDESLRRWKEQLLGVVDLEDVGETP-DP---VVKIL 93

  Fly    75 ALVVEGRDDMELDLT---GDLSQLKKQLFVIKEGVQYKVRIDFIVQREIVHGLKYVQKTSRLGVN 136
            .|.:...|..|:.||   ..|...|...|.||||.:|.:..:|.|...||.||:|.....:.||.
plant    94 DLTIRSPDREEMVLTIPEDGLPNPKGPWFTIKEGSKYTLVFNFRVTNNIVSGLRYNNTVWKTGVK 158

  Fly   137 VDKMKHMVGSYPPKKEIQFYLTPAEEAPSGTFSRGTYSVSSVFTDDDKHIHLEWDWTFEIKKDW 200
            ||..|.|:|::.|:.|...::.|.|..|||.|:||:||..:.|.|||...:||.::||:|:|.|
plant   159 VDSTKAMLGTFSPQAESYQHVMPEEMTPSGMFARGSYSARTKFIDDDNKCYLEINYTFDIRKSW 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGDINP_001262080.1 Rho_GDI 14..199 CDD:280310 71/187 (38%)
AT1G62450NP_176435.1 Rho_GDI 48..220 CDD:366924 69/175 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 128 1.000 Domainoid score I1731
eggNOG 1 0.900 - - E1_KOG3205
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I1854
OMA 1 1.010 - - QHG54245
OrthoDB 1 1.010 - - D1265661at2759
OrthoFinder 1 1.000 - - FOG0001289
OrthoInspector 1 1.000 - - otm3481
orthoMCL 1 0.900 - - OOG6_102354
Panther 1 1.100 - - O PTHR10980
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X792
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.