DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGDI and AT1G12070

DIOPT Version :9

Sequence 1:NP_001262080.1 Gene:RhoGDI / 40179 FlyBaseID:FBgn0036921 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_172671.1 Gene:AT1G12070 / 837759 AraportID:AT1G12070 Length:223 Species:Arabidopsis thaliana


Alignment Length:194 Identity:71/194 - (36%)
Similarity:107/194 - (55%) Gaps:7/194 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PEHHDDDVHDANYQAPPEKTIEEIMAADQEDESLRRYKEALLGAAQTEKIIVEPNDPRKVIVKKL 74
            |...|::..|...:..|...::|.:..|::||||||:||.|||:...|::...| ||   :||.|
plant    33 PTDDDEEEEDKKLELGPMIALKEQLEKDKDDESLRRWKEQLLGSVDLEEVGETP-DP---LVKIL 93

  Fly    75 ALVVEG--RDDMELDLTGDLSQLKK-QLFVIKEGVQYKVRIDFIVQREIVHGLKYVQKTSRLGVN 136
            .|.:..  |:||.|.:..:.....| ..|.:|||.:|.:...|.|...||.||:|.....:.|:.
plant    94 TLTIRSPDREDMVLTIPENGKPASKGPWFTLKEGSKYTLIFTFRVTNNIVSGLQYSNTVWKTGIK 158

  Fly   137 VDKMKHMVGSYPPKKEIQFYLTPAEEAPSGTFSRGTYSVSSVFTDDDKHIHLEWDWTFEIKKDW 200
            |...|.|:|::.|:.|...::...|.||||...||:|||.|.|.|||...:||.::||:|:|:|
plant   159 VYSRKEMLGTFSPQAEPYTHVMFEETAPSGLLVRGSYSVKSKFVDDDNQCYLENNYTFDIRKNW 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGDINP_001262080.1 Rho_GDI 14..199 CDD:280310 68/187 (36%)
AT1G12070NP_172671.1 Rho_GDI 48..221 CDD:396612 66/176 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 128 1.000 Domainoid score I1731
eggNOG 1 0.900 - - E1_KOG3205
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I1854
OMA 1 1.010 - - QHG54245
OrthoDB 1 1.010 - - D1265661at2759
OrthoFinder 1 1.000 - - FOG0001289
OrthoInspector 1 1.000 - - otm3481
orthoMCL 1 0.900 - - OOG6_102354
Panther 1 1.100 - - O PTHR10980
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X792
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.