DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGDI and arhgdig

DIOPT Version :9

Sequence 1:NP_001262080.1 Gene:RhoGDI / 40179 FlyBaseID:FBgn0036921 Length:201 Species:Drosophila melanogaster
Sequence 2:XP_012825772.1 Gene:arhgdig / 493242 XenbaseID:XB-GENE-5955954 Length:232 Species:Xenopus tropicalis


Alignment Length:200 Identity:89/200 - (44%)
Similarity:126/200 - (63%) Gaps:3/200 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAETETKHHPEHHDDDVHDANYQAPPEKTIEEIMAADQEDESLRRYKEALLGAAQTEKIIVEPND 65
            ||:.:...|.|...::..:.||:.|..|:::||...|::||||.:||:||||....   :|:.|.
 Frog    34 MADKDGIKHGEEEAEEEVEPNYKPPEMKSVQEIQELDKDDESLIKYKQALLGQLPA---VVDSNA 95

  Fly    66 PRKVIVKKLALVVEGRDDMELDLTGDLSQLKKQLFVIKEGVQYKVRIDFIVQREIVHGLKYVQKT 130
            |...:.:...|..|..:.:.:||:||:|.||.:::::|||..|:|:|.:.|.:|||.||:||..|
 Frog    96 PNVQVTRLTLLCDEAPEPITMDLSGDISHLKDKVYLLKEGCSYRVKISYKVNKEIVSGLRYVHLT 160

  Fly   131 SRLGVNVDKMKHMVGSYPPKKEIQFYLTPAEEAPSGTFSRGTYSVSSVFTDDDKHIHLEWDWTFE 195
            .|.||.||...:|||||.|:.|...||||.||||.|..:||||.:.|.||||||..||.|:|...
 Frog   161 YRKGVKVDSENYMVGSYGPRAEEYEYLTPLEEAPKGMIARGTYLIKSKFTDDDKSDHLSWEWKLA 225

  Fly   196 IKKDW 200
            |||||
 Frog   226 IKKDW 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGDINP_001262080.1 Rho_GDI 14..199 CDD:280310 82/184 (45%)
arhgdigXP_012825772.1 Rho_GDI 54..229 CDD:366924 82/177 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 174 1.000 Domainoid score I3621
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I3861
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1265661at2759
OrthoFinder 1 1.000 - - FOG0001289
OrthoInspector 1 1.000 - - otm47458
Panther 1 1.100 - - O PTHR10980
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2126
SonicParanoid 1 1.000 - - X792
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.190

Return to query results.
Submit another query.