DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGDI and arhgdib

DIOPT Version :9

Sequence 1:NP_001262080.1 Gene:RhoGDI / 40179 FlyBaseID:FBgn0036921 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001006838.1 Gene:arhgdib / 448583 XenbaseID:XB-GENE-943891 Length:200 Species:Xenopus tropicalis


Alignment Length:202 Identity:96/202 - (47%)
Similarity:129/202 - (63%) Gaps:6/202 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAETETKHHPEHHDDDVH-DANYQAPPEKTIEEIMAADQEDESLRRYKEALLGAAQTEKIIVEPN 64
            |.|.|...|....||::. ..||:.||:|:::||...|::||||.:||::|||..   .:..:|:
 Frog     1 MTENEPVPHDVEDDDELDGKLNYKPPPQKSLQEIQELDKDDESLAKYKKSLLGDG---PVAADPS 62

  Fly    65 DPRKVIVKKLALVVEGRDDM-ELDLTGDLSQLKKQLFVIKEGVQYKVRIDFIVQREIVHGLKYVQ 128
            .| .|||.:|.||......: .:||||||:.|||:.|.:||||:|:|:|.|.|.:|||.||||.|
 Frog    63 AP-NVIVTRLTLVCATAPKLITMDLTGDLTNLKKETFALKEGVEYRVKIHFKVTKEIVSGLKYDQ 126

  Fly   129 KTSRLGVNVDKMKHMVGSYPPKKEIQFYLTPAEEAPSGTFSRGTYSVSSVFTDDDKHIHLEWDWT 193
            ...|.||.|.|.:.|||||.|::|...:|||.||||.|..:||||...|.|||||.|.||.|:|.
 Frog   127 YIYRAGVRVTKARFMVGSYGPRQEEYEFLTPLEEAPKGILARGTYLNKSHFTDDDNHNHLSWEWN 191

  Fly   194 FEIKKDW 200
            ..|:|:|
 Frog   192 LTIRKEW 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGDINP_001262080.1 Rho_GDI 14..199 CDD:280310 90/186 (48%)
arhgdibNP_001006838.1 Rho_GDI 8..197 CDD:366924 91/192 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 174 1.000 Domainoid score I3621
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I3861
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1265661at2759
OrthoFinder 1 1.000 - - FOG0001289
OrthoInspector 1 1.000 - - otm47458
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2126
SonicParanoid 1 1.000 - - X792
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.