DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGDI and arhgdia

DIOPT Version :9

Sequence 1:NP_001262080.1 Gene:RhoGDI / 40179 FlyBaseID:FBgn0036921 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001004847.1 Gene:arhgdia / 448131 XenbaseID:XB-GENE-973541 Length:204 Species:Xenopus tropicalis


Alignment Length:206 Identity:97/206 - (47%)
Similarity:131/206 - (63%) Gaps:10/206 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAETETKHHPEH-----HDDDVHDANYQAPPEKTIEEIMAADQEDESLRRYKEALLGAAQTEKII 60
            |||.|......|     :.|:.|..:|:.|.:|:|:||...|::|||||:|||||||.....   
 Frog     1 MAEHEPTSEQLHQIAAENQDEEHSVDYKPPAQKSIKEIQELDEDDESLRKYKEALLGPVPAS--- 62

  Fly    61 VEPNDPRKVIVKKLALVVEGRD-DMELDLTGDLSQLKKQLFVIKEGVQYKVRIDFIVQREIVHGL 124
            .:|..| .|:|.||.|:.:... .:||||||||.:.|||.|.:||||:|:::|.|.|.:|||.||
 Frog    63 TDPGAP-NVMVTKLTLLCDCAPLPLELDLTGDLEKFKKQSFTLKEGVEYRIKISFKVNKEIVSGL 126

  Fly   125 KYVQKTSRLGVNVDKMKHMVGSYPPKKEIQFYLTPAEEAPSGTFSRGTYSVSSVFTDDDKHIHLE 189
            ||.|:|.|.||.:|:..:|||||.|:.:...:|||.||||.|..:||.||:..:||||||..||.
 Frog   127 KYQQQTYRKGVRLDQTSYMVGSYGPRVDEYEFLTPIEEAPKGMLARGCYSIKCLFTDDDKSKHLS 191

  Fly   190 WDWTFEIKKDW 200
            |:|...||.:|
 Frog   192 WEWNLHIKNEW 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGDINP_001262080.1 Rho_GDI 14..199 CDD:280310 91/185 (49%)
arhgdiaNP_001004847.1 Rho_GDI 11..201 CDD:307981 92/193 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 174 1.000 Domainoid score I3621
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H908
Inparanoid 1 1.050 181 1.000 Inparanoid score I3861
OMA 1 1.010 - - QHG54245
OrthoDB 1 1.010 - - D1265661at2759
OrthoFinder 1 1.000 - - FOG0001289
OrthoInspector 1 1.000 - - otm47458
Panther 1 1.100 - - O PTHR10980
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2126
SonicParanoid 1 1.000 - - X792
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.