DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGDI and ARHGDIA

DIOPT Version :9

Sequence 1:NP_001262080.1 Gene:RhoGDI / 40179 FlyBaseID:FBgn0036921 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001288171.1 Gene:ARHGDIA / 396 HGNCID:678 Length:337 Species:Homo sapiens


Alignment Length:137 Identity:67/137 - (48%)
Similarity:91/137 - (66%) Gaps:5/137 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 HDDDVHDANYQAPPEKTIEEIMAADQEDESLRRYKEALLGAAQTEKIIVEPNDPRKVIVKKLALV 77
            :::|.|..||:.|.:|:|:||...|::|||||:|||||||..   .:..:||.| .|:|..|.||
Human    18 NEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRV---AVSADPNVP-NVVVTGLTLV 78

  Fly    78 VEGR-DDMELDLTGDLSQLKKQLFVIKEGVQYKVRIDFIVQREIVHGLKYVQKTSRLGVNVDKMK 141
            .... ..:||||||||...|||.||:||||:|:::|.|.|.||||.|:||:|.|.|.||.:||..
Human    79 CSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTD 143

  Fly   142 HMVGSYP 148
            :|..:.|
Human   144 YMTTTRP 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGDINP_001262080.1 Rho_GDI 14..199 CDD:280310 67/136 (49%)
ARHGDIANP_001288171.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 6/17 (35%)
Rho_GDI 19..>145 CDD:280310 65/129 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147091
Domainoid 1 1.000 197 1.000 Domainoid score I3096
eggNOG 1 0.900 - - E1_KOG3205
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H908
Inparanoid 1 1.050 201 1.000 Inparanoid score I3769
Isobase 1 0.950 - 0 Normalized mean entropy S950
OMA 1 1.010 - - QHG54245
OrthoDB 1 1.010 - - D1265661at2759
OrthoFinder 1 1.000 - - FOG0001289
OrthoInspector 1 1.000 - - otm40282
orthoMCL 1 0.900 - - OOG6_102354
Panther 1 1.100 - - O PTHR10980
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2126
SonicParanoid 1 1.000 - - X792
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.