DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGDI and Arhgdib

DIOPT Version :9

Sequence 1:NP_001262080.1 Gene:RhoGDI / 40179 FlyBaseID:FBgn0036921 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001009600.1 Gene:Arhgdib / 362456 RGDID:1305383 Length:200 Species:Rattus norvegicus


Alignment Length:202 Identity:95/202 - (47%)
Similarity:132/202 - (65%) Gaps:6/202 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAETETKHHPEHHDDDVHD-ANYQAPPEKTIEEIMAADQEDESLRRYKEALLGAAQTEKIIVEPN 64
            |.|.:.:...|..:|::.. .||:.||:|:::|:...|::||||.:||:.|||..   .::.:|.
  Rat     1 MTEKDEQPQLEEGEDELDSKLNYKPPPQKSLKELQEMDKDDESLTKYKKTLLGDV---PVVADPT 62

  Fly    65 DPRKVIVKKLALVVEGR-DDMELDLTGDLSQLKKQLFVIKEGVQYKVRIDFIVQREIVHGLKYVQ 128
            .| .|.|.:|:||.:.. ..:.:||||||..|||..||:|||::|:|:|:|.|.::||.||||||
  Rat    63 VP-NVTVTRLSLVCDSAPGPITMDLTGDLKALKKDTFVLKEGIEYRVKINFKVNKDIVSGLKYVQ 126

  Fly   129 KTSRLGVNVDKMKHMVGSYPPKKEIQFYLTPAEEAPSGTFSRGTYSVSSVFTDDDKHIHLEWDWT 193
            :|.|.|:.|||...|||||.|:.|...:|||.||||.|..:||||...|.||||||..||.|:|.
  Rat   127 QTYRNGMKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLTWEWN 191

  Fly   194 FEIKKDW 200
            ..|||||
  Rat   192 LAIKKDW 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGDINP_001262080.1 Rho_GDI 14..199 CDD:280310 89/186 (48%)
ArhgdibNP_001009600.1 Rho_GDI 15..197 CDD:280310 89/185 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340756
Domainoid 1 1.000 195 1.000 Domainoid score I3054
eggNOG 1 0.900 - - E1_KOG3205
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 199 1.000 Inparanoid score I3718
OMA 1 1.010 - - QHG54245
OrthoDB 1 1.010 - - D1265661at2759
OrthoFinder 1 1.000 - - FOG0001289
OrthoInspector 1 1.000 - - otm44411
orthoMCL 1 0.900 - - OOG6_102354
Panther 1 1.100 - - LDO PTHR10980
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X792
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.