DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGDI and Arhgdia

DIOPT Version :9

Sequence 1:NP_001262080.1 Gene:RhoGDI / 40179 FlyBaseID:FBgn0036921 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001007006.1 Gene:Arhgdia / 360678 RGDID:1359547 Length:204 Species:Rattus norvegicus


Alignment Length:189 Identity:99/189 - (52%)
Similarity:130/189 - (68%) Gaps:5/189 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 HDDDVHDANYQAPPEKTIEEIMAADQEDESLRRYKEALLGAAQTEKIIVEPNDPRKVIVKKLALV 77
            :::|.|..||:.|.:|:|:||...|::|||||:|||||||..   .:..:||.| .|||.:|.||
  Rat    18 NEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRV---AVSADPNVP-NVIVTRLTLV 78

  Fly    78 VE-GRDDMELDLTGDLSQLKKQLFVIKEGVQYKVRIDFIVQREIVHGLKYVQKTSRLGVNVDKMK 141
            .. ....:||||||||...|||.||:||||:|:::|.|.|.||||.|:||:|.|.|.||.:||..
  Rat    79 CSTAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTD 143

  Fly   142 HMVGSYPPKKEIQFYLTPAEEAPSGTFSRGTYSVSSVFTDDDKHIHLEWDWTFEIKKDW 200
            :|||||.|:.|...:|||.||||.|..:||:|::.|.||||||..||.|:|...|||:|
  Rat   144 YMVGSYGPRAEEYEFLTPMEEAPKGMLARGSYNIKSRFTDDDKTDHLSWEWNLTIKKEW 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGDINP_001262080.1 Rho_GDI 14..199 CDD:280310 97/185 (52%)
ArhgdiaNP_001007006.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 6/17 (35%)
Rho_GDI 11..201 CDD:396612 97/186 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340755
Domainoid 1 1.000 195 1.000 Domainoid score I3054
eggNOG 1 0.900 - - E1_KOG3205
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H908
Inparanoid 1 1.050 199 1.000 Inparanoid score I3718
OMA 1 1.010 - - QHG54245
OrthoDB 1 1.010 - - D1265661at2759
OrthoFinder 1 1.000 - - FOG0001289
OrthoInspector 1 1.000 - - otm44411
orthoMCL 1 0.900 - - OOG6_102354
Panther 1 1.100 - - O PTHR10980
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X792
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.