DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGDI and rhi-1

DIOPT Version :9

Sequence 1:NP_001262080.1 Gene:RhoGDI / 40179 FlyBaseID:FBgn0036921 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_508774.1 Gene:rhi-1 / 180721 WormBaseID:WBGene00004356 Length:191 Species:Caenorhabditis elegans


Alignment Length:190 Identity:82/190 - (43%)
Similarity:117/190 - (61%) Gaps:4/190 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EHHDDDVHDANYQAPPEKTIEEIMAADQEDESLRRYKEALLGAAQTEKIIVEPNDPRKVIVKKLA 75
            |:..::..:..|:.||:|:|:|::.||:|||||:.||..|||..   .:||:..:|.:|||:.:.
 Worm     5 ENTGENTSEYQYKQPPQKSIDELLNADKEDESLKVYKAKLLGQG---TVIVDEKNPLRVIVRSVE 66

  Fly    76 LVVEGRDDMELDLTGDLSQLKKQLFV-IKEGVQYKVRIDFIVQREIVHGLKYVQKTSRLGVNVDK 139
            |::.|:.....||:.....:...|.| ||||..|::...|.|||||..||.|..|..|.|:.|:.
 Worm    67 LLINGKTAQSFDLSDPAKLVNSDLSVSIKEGSNYRLSFAFHVQREITSGLHYKHKVKRSGITVEN 131

  Fly   140 MKHMVGSYPPKKEIQFYLTPAEEAPSGTFSRGTYSVSSVFTDDDKHIHLEWDWTFEIKKD 199
            .|:|:|||.||.|||.|.:|.||||||...||.|.|.|..||||.:::|:|.||..|.|:
 Worm   132 EKYMMGSYAPKLEIQEYKSPNEEAPSGMMHRGKYKVYSKITDDDNNVYLDWQWTLHITKE 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGDINP_001262080.1 Rho_GDI 14..199 CDD:280310 80/185 (43%)
rhi-1NP_508774.1 Rho_GDI 9..191 CDD:280310 80/184 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159255
Domainoid 1 1.000 160 1.000 Domainoid score I2461
eggNOG 1 0.900 - - E1_KOG3205
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H908
Inparanoid 1 1.050 161 1.000 Inparanoid score I2869
Isobase 1 0.950 - 0 Normalized mean entropy S950
OMA 1 1.010 - - QHG54245
OrthoDB 1 1.010 - - D1265661at2759
OrthoFinder 1 1.000 - - FOG0001289
OrthoInspector 1 1.000 - - oto19205
orthoMCL 1 0.900 - - OOG6_102354
Panther 1 1.100 - - LDO PTHR10980
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2126
SonicParanoid 1 1.000 - - X792
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1615.790

Return to query results.
Submit another query.