DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8004 and AT2G19080

DIOPT Version :9

Sequence 1:NP_649161.1 Gene:CG8004 / 40178 FlyBaseID:FBgn0036920 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_565446.1 Gene:AT2G19080 / 816425 AraportID:AT2G19080 Length:315 Species:Arabidopsis thaliana


Alignment Length:252 Identity:44/252 - (17%)
Similarity:88/252 - (34%) Gaps:69/252 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SCLAVKAYLKMCNLPFLIRSCANAEHMSPGGRMTKLPFIRAGAFIFAEFEPIVNFVEQKELAIGS 106
            :||....|||:..|||      .....|......:||:..:..::                   :
plant    27 NCLPAYIYLKLAQLPF------ELAFNSTFPDSDELPYFESDTYV-------------------A 66

  Fly   107 WQDED----EKADMRTYVSL------VENIFTMAELYISFKNERVYKEVTAPRNGVV-------- 153
            :.:||    ||......|:|      :.:..::..|.:|:..|.:..|:.....|:.        
plant    67 YNNEDGGVIEKLKKDGIVNLDSQLQSLSDYLSLKALIVSWLEEALTYEIWVGTEGISTSKIYYSD 131

  Fly   154 FPWPLNHMQNYGK---RRNALRLLK---------VYQWDDLDIDSVIDKVAKCCETLEYKLKESP 206
            .||.::.:..|.:   .:|.|.:.|         :|:           :.::..|.|..:|.|. 
plant   132 LPWVISKVLFYKQTYLAKNRLGITKENAEQREKQIYK-----------RASEAYEALSTRLGEQ- 184

  Fly   207 ETPFFYGDQPCELDAIAFGHLFSILTTTLPNMALAQTVQKFQHLVEFCRFVDEKYFQ 263
              .|.:.|:|..|||....|:..|:........|...:.:..:||.:...:..::.:
plant   185 --KFLFEDRPSSLDAFLLSHILFIIQALPVTSVLRCKLLEHSNLVRYAEKLKSEFLE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8004NP_649161.1 GST_N_Metaxin2 24..100 CDD:239377 11/57 (19%)
GST_C_Metaxin2 130..258 CDD:198320 27/147 (18%)
AT2G19080NP_565446.1 GST_N_4 26..121 CDD:407300 21/118 (18%)
GST_C_Metaxin 164..234 CDD:198302 16/83 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1219712at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105112
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.