DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8004 and Mtx3

DIOPT Version :9

Sequence 1:NP_649161.1 Gene:CG8004 / 40178 FlyBaseID:FBgn0036920 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_003749215.1 Gene:Mtx3 / 688905 RGDID:1583002 Length:311 Species:Rattus norvegicus


Alignment Length:234 Identity:61/234 - (26%)
Similarity:99/234 - (42%) Gaps:14/234 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LPE-NASCLAVKAYLKMCNLPFLIRSCANAEHMSPGGRMTKLPFIRAGAFIFAEFEPIVNFVEQK 100
            ||. ::..|.|.||.|....|..:....|. ...|.|   .:|.:.....|.::.|.|:||:.::
  Rat    16 LPSVHSESLVVLAYAKFSGAPLKVNIIDNT-WRGPRG---DVPILTTEDSIVSKPEKILNFLRKQ 76

  Fly   101 ELAIGSWQDEDEKADMRTYVSLVENIFTMAELYISFKNERVYKEVTAPRNGVVFPWPLNHMQNYG 165
            :..........:.||...|::|:|.......|:..:.....|..||.|......|:||:.:....
  Rat    77 KFNADCELSAKQGADTLAYIALLEEKLLPGVLHTFWVENDNYFTVTKPWFASRIPFPLSLILPGR 141

  Fly   166 KRRNAL-RLLKVYQWDDL----DIDSVIDKVAK-CCETLEYKLKESPETPFFYGDQPCELDAIAF 224
            ..|.|| |:|.......|    |:::.|.:.|| |...|..:|..|   .||:||.|..|||..|
  Rat   142 MSRGALNRILLTRGVPPLYHVQDVEAQIYRDAKECLNLLSNRLGTS---QFFFGDTPSTLDAYVF 203

  Fly   225 GHLFSILTTTLPNMALAQTVQKFQHLVEFCRFVDEKYFQ 263
            |.|..:.....|.:.|.:.:::..:|...|..:.:.||:
  Rat   204 GFLAPLYKVRFPKVHLQEHLKQLPNLCRLCDDILDSYFR 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8004NP_649161.1 GST_N_Metaxin2 24..100 CDD:239377 17/63 (27%)
GST_C_Metaxin2 130..258 CDD:198320 37/133 (28%)
Mtx3XP_003749215.1 Tom37 23..142 CDD:402277 28/122 (23%)
GST_C_Metaxin1_3 105..241 CDD:198321 37/138 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422112at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.