DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8004 and Mtx2

DIOPT Version :9

Sequence 1:NP_649161.1 Gene:CG8004 / 40178 FlyBaseID:FBgn0036920 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_058084.3 Gene:Mtx2 / 53375 MGIID:1859652 Length:263 Species:Mus musculus


Alignment Length:259 Identity:110/259 - (42%)
Similarity:164/259 - (63%) Gaps:11/259 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YLSQLITADKLSAEPWPEDATLYQPYEAEQILLPENASCLAVKAYLKMCNLPFLIRSCANAEHMS 69
            ::||:     .:.|||||:|||||....|||||.:||:.|||:|:|:|||||..:...||||:||
Mouse     8 FVSQI-----AATEPWPENATLYQQLRGEQILLSDNAASLAVQAFLQMCNLPVKVVCRANAEYMS 67

  Fly    70 PGGRMTKLPFIRAGAFIFAEFEPIVNFVEQKELAIGSWQDEDEKADMRTYVSLVENIFTMAELYI 134
            |.|   |:|||..|..:.:|..|||.||:.|..::....||.:||:|:.|:.||.|:...||||:
Mouse    68 PSG---KVPFIHVGNQVVSELGPIVQFVKAKGHSLSDGLDEVQKAEMKAYMELVNNMLLTAELYL 129

  Fly   135 SFKNERVYKEVTAPRNGVVFPWPLNHMQNYGKRRNALRLLKVYQWDDLDIDSVIDKVAKCCETLE 199
            .:.:|....|:|..|.|..:||||||:..|.|:....|.:|...|.:..:|.|::.|.:||:.|.
Mouse   130 QWCDEATVGEITIARYGSPYPWPLNHILAYQKQWEVKRKMKAIGWGNKTLDQVLEDVDQCCQALS 194

  Fly   200 YKLKESPETPFFYGDQPCELDAIAFGHLFSILTTTLPNMALAQTVQKFQHLVEFCRFVDEKYFQ 263
            .:|...   |:|:..||.||||:.||||::||||.|.:..|::.|:.:.:|:.|||.:::.||:
Mouse   195 QRLGTQ---PYFFNKQPTELDALVFGHLYTILTTQLTSDELSEKVKNYSNLLAFCRRIEQHYFE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8004NP_649161.1 GST_N_Metaxin2 24..100 CDD:239377 41/75 (55%)
GST_C_Metaxin2 130..258 CDD:198320 50/127 (39%)
Mtx2NP_058084.3 GST_N_Metaxin2 22..95 CDD:239377 41/75 (55%)
GstA 33..252 CDD:223698 94/224 (42%)
GST_C_Metaxin2 125..250 CDD:198320 50/127 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849471
Domainoid 1 1.000 110 1.000 Domainoid score I6328
eggNOG 1 0.900 - - E1_KOG3027
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4777
Inparanoid 1 1.050 220 1.000 Inparanoid score I3547
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52965
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005469
OrthoInspector 1 1.000 - - otm42663
orthoMCL 1 0.900 - - OOG6_105112
Panther 1 1.100 - - LDO PTHR12289
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2657
SonicParanoid 1 1.000 - - X3890
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.