DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8004 and MTX1

DIOPT Version :9

Sequence 1:NP_649161.1 Gene:CG8004 / 40178 FlyBaseID:FBgn0036920 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_002446.3 Gene:MTX1 / 4580 HGNCID:7504 Length:466 Species:Homo sapiens


Alignment Length:230 Identity:60/230 - (26%)
Similarity:97/230 - (42%) Gaps:22/230 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LAVKAYLKMCNLPFLIRSCANAEHMSPGGRMTKLPFIRA--GAFIFAEFEPIVNFVEQKELAIGS 106
            |||..|.:....|..:...:| ...||.|   .||.:|.  |..|....:.|.:..::|..|   
Human   173 LAVLTYARFTGAPLKVHKISN-PWQSPSG---TLPALRTSHGEVISVPHKIITHLRKEKYNA--- 230

  Fly   107 WQDED----EKADMRTYVSLVENIFTMAELYISFKNERVYKEVTAPRNGVVFPWPLN-----HMQ 162
              |.|    :.||...::||:|.......::..:.:.:.|.|||........|:|||     .||
Human   231 --DYDLSARQGADTLAFMSLLEEKLLPVLVHTFWIDTKNYVEVTRKWYAEAMPFPLNFFLPGRMQ 293

  Fly   163 NYGKRRNALRLLKVYQWDDLDIDSVIDKVAKCCETLEYKLKESPETPFFYGDQPCELDAIAFGHL 227
            .....|..|...:....|:.:::..:.:.|:.|.||..:...|.:  ||:||.|..|||..|.:|
Human   294 RQYMERLQLLTGEHRPEDEEELEKELYREARECLTLLSQRLGSQK--FFFGDAPASLDAFVFSYL 356

  Fly   228 FSILTTTLPNMALAQTVQKFQHLVEFCRFVDEKYF 262
            ..:|...||:..|...::...:|..:|..:...||
Human   357 ALLLQAKLPSGKLQVHLRGLHNLCAYCTHILSLYF 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8004NP_649161.1 GST_N_Metaxin2 24..100 CDD:239377 15/57 (26%)
GST_C_Metaxin2 130..258 CDD:198320 34/132 (26%)
MTX1NP_002446.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..133
Tom37 156..293 CDD:313732 32/128 (25%)
GST_C_Metaxin1_3 255..391 CDD:198321 34/137 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422112at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2657
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.