DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8004 and mtx2

DIOPT Version :9

Sequence 1:NP_649161.1 Gene:CG8004 / 40178 FlyBaseID:FBgn0036920 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001004770.1 Gene:mtx2 / 447951 XenbaseID:XB-GENE-943941 Length:274 Species:Xenopus tropicalis


Alignment Length:263 Identity:110/263 - (41%)
Similarity:165/263 - (62%) Gaps:11/263 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSQYLSQLITADKLSAEPWPEDATLYQPYEAEQILLPENASCLAVKAYLKMCNLPFLIRSCANA 65
            :|..::||:     .:.|||||:|.||||.::||:||.:|||||||:|:|||||||..:...|||
 Frog     4 VTDAFVSQI-----AAVEPWPENAALYQPLKSEQVLLSDNASCLAVQAFLKMCNLPVQVVCRANA 63

  Fly    66 EHMSPGGRMTKLPFIRAGAFIFAEFEPIVNFVEQKELAIGSWQDEDEKADMRTYVSLVENIFTMA 130
            |:|||.|   |:|||..|..:.:|..|||.||:.|..::....||.::|:|:.|:.||.|:...|
 Frog    64 EYMSPSG---KVPFIHVGNQVISELGPIVQFVKAKGHSLSDGLDEVQRAEMKAYMELVNNMLLTA 125

  Fly   131 ELYISFKNERVYKEVTAPRNGVVFPWPLNHMQNYGKRRNALRLLKVYQWDDLDIDSVIDKVAKCC 195
            ||||.:.:|...:|:|.||....:.||||:...:.::....|.:|...|....::.|.:.|.:||
 Frog   126 ELYIQWCDEATLEEITQPRYSFPYSWPLNYFLVFQRKWEIKRKMKAIGWATKTLEQVFEDVDQCC 190

  Fly   196 ETLEYKLKESPETPFFYGDQPCELDAIAFGHLFSILTTTLPNMALAQTVQKFQHLVEFCRFVDEK 260
            :.|..:|...   |:|:..||.||||:.|||||:||||.|.|..|.:.|:.:.:|:.|||.:::.
 Frog   191 QALSQRLGTQ---PYFFNKQPTELDALVFGHLFTILTTQLTNDELQEKVKNYSNLIAFCRRIEQH 252

  Fly   261 YFQ 263
            ||:
 Frog   253 YFE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8004NP_649161.1 GST_N_Metaxin2 24..100 CDD:239377 43/75 (57%)
GST_C_Metaxin2 130..258 CDD:198320 48/127 (38%)
mtx2NP_001004770.1 GST_N_Metaxin2 22..95 CDD:239377 43/75 (57%)
GST_C_Metaxin2 125..250 CDD:198320 48/127 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I6286
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4777
Inparanoid 1 1.050 169 1.000 Inparanoid score I4021
OMA 1 1.010 - - QHG52965
OrthoDB 1 1.010 - - D1219712at2759
OrthoFinder 1 1.000 - - FOG0005469
OrthoInspector 1 1.000 - - otm47765
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2657
SonicParanoid 1 1.000 - - X3890
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.010

Return to query results.
Submit another query.