DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8004 and CG9393

DIOPT Version :9

Sequence 1:NP_649161.1 Gene:CG8004 / 40178 FlyBaseID:FBgn0036920 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_649908.1 Gene:CG9393 / 41152 FlyBaseID:FBgn0037710 Length:327 Species:Drosophila melanogaster


Alignment Length:256 Identity:59/256 - (23%)
Similarity:98/256 - (38%) Gaps:33/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ATLYQPYEAEQILLPENASCLAVKAYLKMCNLPFLIRSCANAEHMSPGGRMTKLPFIRAGAFIFA 88
            |.|| .|:.|..|...:..||.....|:....|..:::.:|......|    |||:::.|...||
  Fly     7 AMLY-VYKGEYGLPSIDFECLRALCLLRFTRCPMDVQTSSNPLRSGAG----KLPYLQIGNQKFA 66

  Fly    89 EFEPIVNFVEQKELAIGSWQDEDEKADMRTYVSLVENIFTMAELYISF-------KNERVYKEVT 146
            .:..|...::.:...|.:.....:|.....|.:.|   ||....|..:       ..:...:.:.
  Fly    67 GYRQIKRVLDLEGYPIDAHLSTKQKHLSTAYANWV---FTNLHAYYHYFLFGEPHNFDTTTRGLY 128

  Fly   147 APRNGVVFPWPLNHMQNYGKRRNALRLLKVYQWDDLDIDSVIDK---------VAKCCETLEYKL 202
            |.|.    |:|.|.......:|.|..:::|..  ..|::..:||         ..|....|..||
  Fly   129 AKRT----PFPFNFYYPSSYQREACDVVQVMA--GFDVNDKLDKHEGDYLVVNAKKVVNLLSRKL 187

  Fly   203 KESPETPFFYGDQPCELDAIAFGHLFSILTTTLPNMALAQTVQKFQHLVEFCRFVDEKYFQ 263
            ...   .:|:||...|.|||.:.:|..|....|||..|...::..|:||.|...:.:..|:
  Fly   188 GRK---VWFFGDTYSEFDAIVYSYLAIIFKIALPNNPLQNHIKGCQNLVNFINRITKDIFR 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8004NP_649161.1 GST_N_Metaxin2 24..100 CDD:239377 19/75 (25%)
GST_C_Metaxin2 130..258 CDD:198320 33/143 (23%)
CG9393NP_649908.1 GST_N_Metaxin1_like 8..79 CDD:239376 18/75 (24%)
GST_C_Metaxin1_3 108..244 CDD:198321 33/144 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469154
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422112at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12289
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2657
SonicParanoid 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.