DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8004 and mtx3

DIOPT Version :9

Sequence 1:NP_649161.1 Gene:CG8004 / 40178 FlyBaseID:FBgn0036920 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_991184.1 Gene:mtx3 / 402916 ZFINID:ZDB-GENE-021210-3 Length:313 Species:Danio rerio


Alignment Length:188 Identity:47/188 - (25%)
Similarity:81/188 - (43%) Gaps:29/188 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 EP--IVNFVEQKELAIGSWQDEDEKADMRTYVSLVENIFTMAELYISFKNERVYKEVTAPRNGVV 153
            ||  |:||:.::...........:.||...|::|:|.....|.|:..:.:...|..:|.      
Zfish    65 EPTQILNFLRKQR
FNADFELTAKQGADTMAYIALLEEKLRPALLHTFWVDAENYANLTR------ 123

  Fly   154 FPW-------PLNHMQNYGKRRNALRLLKVY----QWDDLDIDSVIDKV----AKCCETLEYKLK 203
             ||       |||..  ...|:.:|.|.::.    :...|:|..|..|:    .:|...|.::| 
Zfish   124 -PWFTSHSLFPLNFF--VPGRQASLALSRILLTKAESPLLNITEVEGKIYSEAKECLNLLSHRL- 184

  Fly   204 ESPETPFFYGDQPCELDAIAFGHLFSILTTTLPNMALAQTVQKFQHLVEFCRFVDEKY 261
              ....||:||.|..|||..|||:..::...||:..|.:.:.:..:|.:||..:.:.|
Zfish   185 --GNFNFFFGDTPTSLDAFVFGHIAPLIKAPLPSGQLQKHLNQLDNLCQFCNTILKNY 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8004NP_649161.1 GST_N_Metaxin2 24..100 CDD:239377 5/10 (50%)
GST_C_Metaxin2 130..258 CDD:198320 36/142 (25%)
mtx3NP_991184.1 GST_N_Metaxin1_like 5..77 CDD:239376 5/11 (45%)
GST_C_Metaxin1_3 105..241 CDD:198321 37/148 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..313
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422112at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2657
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.