DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8004 and Mtx1

DIOPT Version :9

Sequence 1:NP_649161.1 Gene:CG8004 / 40178 FlyBaseID:FBgn0036920 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_008759357.1 Gene:Mtx1 / 295241 RGDID:1559791 Length:503 Species:Rattus norvegicus


Alignment Length:334 Identity:75/334 - (22%)
Similarity:113/334 - (33%) Gaps:108/334 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ADKLSAEPWPEDATLYQPYEAEQILLPENASC------------------------LAVKAYLKM 52
            |:......|.|.|..|:.      :||....|                        |||..|.:.
  Rat   119 AETRGCSSWREKADAYER------VLPGQRMCKMAAPMELFCWSGGWGLPSVDLDSLAVLTYTRF 177

  Fly    53 CNLPFLIRSCANAEHMSPGGRMTKLPFIR--AGAFIFAEFEPIVNFVEQKELAIGSWQDED---- 111
            ...|..:...:| ...||.|   .||.:|  :|..|....:.|.:..::|..|     |.|    
  Rat   178 TCAPLKVHKISN-PWQSPSG---TLPALRTSSGKVITEPHKIITHLRKEKYNA-----DYDLSAR 233

  Fly   112 EKADMRTYVSLVE-------------------------------------NIF------TMAELY 133
            :.||...::||:|                                     ::|      .:...:
  Rat   234 QGADTLAFISLLEEKLLPMLVSTPSLQGDILRVPGDLVACPVSGSCTGSDSVFLSVCPIQIHTFW 298

  Fly   134 ISFKNERVYKEVTAPRNGVVFPWPLN-----HMQNYGKRRNALRLLKVYQWDDLDIDSVIDK--- 190
            |..||   |.|||........|:|||     .||    ||:..||..:.....|:.:..::|   
  Rat   299 IDAKN---YVEVTRKWYAEAMPFPLNFFLPGRMQ----RRHMERLQLLCGEHRLESEEELEKELY 356

  Fly   191 --VAKCCETLEYKLKESPETPFFYGDQPCELDAIAFGHLFSILTTTLPNMALAQTVQKFQHLVEF 253
              ..:|...|.::|   ....||:||.|..|||..|.||..:|...||:..|...::..|:|..:
  Rat   357 QEARECLTLLSHRL---GSRKFFFGDAPASLDAFVFSHLVLLLQAKLPSGKLQAHLRGLQNLCVY 418

  Fly   254 CRFVDEKYF 262
            |..:...||
  Rat   419 CTHILNLYF 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8004NP_649161.1 GST_N_Metaxin2 24..100 CDD:239377 20/101 (20%)
GST_C_Metaxin2 130..258 CDD:198320 40/137 (29%)
Mtx1XP_008759357.1 GST_N_Metaxin1_like 150..223 CDD:239376 15/76 (20%)
GST_C_Metaxin1_3 291..427 CDD:198321 40/145 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422112at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.