DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8004 and mtx1b

DIOPT Version :9

Sequence 1:NP_649161.1 Gene:CG8004 / 40178 FlyBaseID:FBgn0036920 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001007281.1 Gene:mtx1b / 286740 ZFINID:ZDB-GENE-021210-1 Length:317 Species:Danio rerio


Alignment Length:237 Identity:69/237 - (29%)
Similarity:100/237 - (42%) Gaps:21/237 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LPE-NASCLAVKAYLKMCNLPFLIRSCANAEHMSPGGRMTKLPFIRAGAFIFAEFEPIVNFVEQK 100
            ||. :..||||.||.|....|..:....| ...||.|.:..|.....|: |....:.|::..:||
Zfish    16 LPSVDVDCLAVLAYAKFAGAPLKVHKITN-PWRSPTGSLPALKTREEGS-ISQPSKIIIHLRKQK 78

  Fly   101 ELAIGSWQDED----EKADMRTYVSLVENIFTMAELYISFKNERVYKEVTAPRNGVVFPWPLNHM 161
            ..|     |.|    |.||...:|||:|.....|.:|..:.:.:.|.:||........|:|||.:
Zfish    79 YNA-----DYDLSAKEGADTLAFVSLLEEKLLPALVYTLWIDSKNYVDVTRCWYAENIPFPLNFL 138

  Fly   162 QNYGKRRNALRLLKVYQWDD-LDIDSVIDK-----VAKCCETLEYKLKESPETPFFYGDQPCELD 220
            .........|..|::.:.|. |:....::|     ..:|...|..:|...   .||:||.|..||
Zfish   139 LPNRMHSQQLEKLRLVRGDPVLEPGEQLEKELYRDAFECMTLLSQRLGSQ---KFFFGDSPSSLD 200

  Fly   221 AIAFGHLFSILTTTLPNMALAQTVQKFQHLVEFCRFVDEKYF 262
            |..|.||..:|...|||..|.|.:....:|.:||..:...||
Zfish   201 AYVFAHLAPLLKIKLPNGKLQQHLNSLNNLEQFCSNILLLYF 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8004NP_649161.1 GST_N_Metaxin2 24..100 CDD:239377 18/63 (29%)
GST_C_Metaxin2 130..258 CDD:198320 37/133 (28%)
mtx1bNP_001007281.1 GST_N_Metaxin1_like 5..78 CDD:239376 18/63 (29%)
GST_C_Metaxin1_3 106..242 CDD:198321 37/138 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422112at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2657
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.