DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8004 and SPAC589.04

DIOPT Version :9

Sequence 1:NP_649161.1 Gene:CG8004 / 40178 FlyBaseID:FBgn0036920 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_594052.1 Gene:SPAC589.04 / 2542623 PomBaseID:SPAC589.04 Length:271 Species:Schizosaccharomyces pombe


Alignment Length:202 Identity:45/202 - (22%)
Similarity:78/202 - (38%) Gaps:42/202 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 AEHMSPGGRMTKLPFIRAGAFIFAEFEPIVNFVEQKELAIGS------WQDEDEKADMRTYVSLV 123
            :.|.||.   .|:|||:               :|.::|.:..      .:||.....:..::||:
pombe    78 SNHASPD---EKVPFIQ---------------IESRKLVLNPSLLQYFLKDESTLQQISPWMSLL 124

  Fly   124 ENIFTMAELYISFKNERVYKEVT---APRNGVVFPWPLNHMQNYG-----KRRNALRLLKVYQWD 180
            .|....|.|...:.:...:.|:.   .|.    ..||||.:::.|     ||:..|:|.:    .
pombe   125 INQVETAILLTMYLDNENFSEIQKKWLPN----MSWPLNIIKSIGLPSQIKRKICLQLNE----S 181

  Fly   181 DLDIDSVIDKVAKCCETLEYKLKESPETPFFYGDQPCELDAIAFGHLFSILTTTLPNMALAQTVQ 245
            .||.|::::..:|....|...|  ..:..||..:.|..||...|.|...|....|.|..|...:.
pombe   182 TLDFDAILEDASKAFSALSELL--GSDKWFFNNESPSFLDVSLFAHAEIINHLPLKNDQLKVVLG 244

  Fly   246 KFQHLVE 252
            ..::|.:
pombe   245 THKNLTD 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8004NP_649161.1 GST_N_Metaxin2 24..100 CDD:239377 8/34 (24%)
GST_C_Metaxin2 130..258 CDD:198320 31/131 (24%)
SPAC589.04NP_594052.1 Thioredoxin_like 40..110 CDD:294274 9/49 (18%)
AAT_I 88..>195 CDD:302748 26/129 (20%)
GST_C_Metaxin 185..257 CDD:198302 16/69 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005469
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105112
Panther 1 1.100 - - O PTHR12289
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2657
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.900

Return to query results.
Submit another query.