DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8004 and SPBC409.19c

DIOPT Version :9

Sequence 1:NP_649161.1 Gene:CG8004 / 40178 FlyBaseID:FBgn0036920 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001342904.1 Gene:SPBC409.19c / 2540958 PomBaseID:SPBC409.19c Length:450 Species:Schizosaccharomyces pombe


Alignment Length:279 Identity:61/279 - (21%)
Similarity:108/279 - (38%) Gaps:60/279 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LYQPYEAEQILLPENASCLAVKAYLKMCNLPF------LIRSCANAEHMSPGGRMTKLPFIRAGA 84
            :|.|...:..:.|   .|||...|   |.|..      ::|: ||: .|||   ..|||.:..|.
pombe     6 IYSPGLGQPTMDP---GCLAALIY---CALAVPKDEIEILRT-ANS-GMSP---THKLPALWDGH 59

  Fly    85 FIFAEFEPIVNFVEQKELAIGSWQDEDEKADMRTYVSLVENIFTMAELYISFKNERVYKEVTAPR 149
            ......:.|:.:::||...:.:: |..:.|::..:.||:|.......|..:|.||..:.|...|.
pombe    60 VWIGSLKNILIYLKQKGYNLDNF-DAKQLANVMAFTSLLEGSVNDLWLLEAFVNEENFVEAIRPA 123

  Fly   150 NGVVFPWPLNH-----MQNYGKRR--------------NALRLLKVYQWDD-------------- 181
            ......:|.|:     :|...|.|              .|.|:...::|.:              
pombe   124 WSKALKFPHNYLTPNALQRQAKERLAQTLGIRDEEVSYEASRMPISHKWTNATRHRQALLRTQAR 188

  Fly   182 -LDIDSVIDKVAKCCETLEYKLKESPETPFFYGDQPCELDAIAFGHL-FSILTTTLPNMALAQTV 244
             :.|.|:..:|....|:|      ..::.|.:|::|..||.:.:.:| |...|..||...|...:
pombe   189 RIRISSLARQVYGSLESL------ISDSKFIFGEKPTSLDCLFYAYLSFHAFTNELPQATLRPCL 247

  Fly   245 Q-KFQHLVEFCRFVDEKYF 262
            | ....|..:.:.:.|.:|
pombe   248 QFNSPKLYAYLKSLRETWF 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8004NP_649161.1 GST_N_Metaxin2 24..100 CDD:239377 20/79 (25%)
GST_C_Metaxin2 130..258 CDD:198320 32/163 (20%)
SPBC409.19cNP_001342904.1 Tom37 4..141 CDD:313732 35/146 (24%)
GST_C_Metaxin 189..262 CDD:198302 18/78 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12289
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2657
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
44.000

Return to query results.
Submit another query.