DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8004 and Mtx1

DIOPT Version :9

Sequence 1:NP_649161.1 Gene:CG8004 / 40178 FlyBaseID:FBgn0036920 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001344296.2 Gene:Mtx1 / 17827 MGIID:103025 Length:355 Species:Mus musculus


Alignment Length:269 Identity:65/269 - (24%)
Similarity:99/269 - (36%) Gaps:62/269 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LAVKAYLKMCNLPFLIRSCANAEHMSPGG--------------------RMTK------------ 76
            |||..|.:....|..|...:| ...||.|                    .||:            
Mouse    24 LAVLTYTRFTGAPLKIHKTSN-PWQSPSGIPEGQECARGGAGDRNAMQMSMTRQAGPCEYTSFSI 87

  Fly    77 ---LPFIRA--GAFIFAEFEPIVNFVEQKELAIGSWQDED----EKADMRTYVSLVENIFTMAEL 132
               ||.:|.  |..|....:.|.:..::|..|     |.|    :.||...::||:|.......:
Mouse    88 SGTLPALRTSDGKVITVPHKIITHLRKEKYNA-----DYDLSARQGADTLAFMSLLEEKLLPVLI 147

  Fly   133 YISFKNERVYKEVTAPRNGVVFPWPLN-----HMQNYGKRRNALRLL----KVYQWDDLDIDSVI 188
            :..:.:.:.|.|||........|:|||     .||.....|  |:||    |....::|: ..:.
Mouse   148 HTFWIDAKNYVEVTRKWYAEAMPFPLNFFLPGRMQRQYMER--LQLLCGEHKSENEEELE-KELY 209

  Fly   189 DKVAKCCETLEYKLKESPETPFFYGDQPCELDAIAFGHLFSILTTTLPNMALAQTVQKFQHLVEF 253
            .:..:|...|..:|...   .||:||.|..|||..|.||..:|...||:..|...::...:|..:
Mouse   210 QEARECLTLLSQRLGSQ---KFFFGDAPASLDAFVFSHLALLLQAKLPSGKLQAHLRGLHNLCAY 271

  Fly   254 CRFVDEKYF 262
            |..:...||
Mouse   272 CTHILNLYF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8004NP_649161.1 GST_N_Metaxin2 24..100 CDD:239377 18/92 (20%)
GST_C_Metaxin2 130..258 CDD:198320 36/136 (26%)
Mtx1NP_001344296.2 Tom37 23..182 CDD:371142 35/163 (21%)
GST_C_Metaxin1_3 144..280 CDD:198321 36/141 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422112at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2657
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.