Sequence 1: | NP_649161.1 | Gene: | CG8004 / 40178 | FlyBaseID: | FBgn0036920 | Length: | 269 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001344296.2 | Gene: | Mtx1 / 17827 | MGIID: | 103025 | Length: | 355 | Species: | Mus musculus |
Alignment Length: | 269 | Identity: | 65/269 - (24%) |
---|---|---|---|
Similarity: | 99/269 - (36%) | Gaps: | 62/269 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 LAVKAYLKMCNLPFLIRSCANAEHMSPGG--------------------RMTK------------ 76
Fly 77 ---LPFIRA--GAFIFAEFEPIVNFVEQKELAIGSWQDED----EKADMRTYVSLVENIFTMAEL 132
Fly 133 YISFKNERVYKEVTAPRNGVVFPWPLN-----HMQNYGKRRNALRLL----KVYQWDDLDIDSVI 188
Fly 189 DKVAKCCETLEYKLKESPETPFFYGDQPCELDAIAFGHLFSILTTTLPNMALAQTVQKFQHLVEF 253
Fly 254 CRFVDEKYF 262 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8004 | NP_649161.1 | GST_N_Metaxin2 | 24..100 | CDD:239377 | 18/92 (20%) |
GST_C_Metaxin2 | 130..258 | CDD:198320 | 36/136 (26%) | ||
Mtx1 | NP_001344296.2 | Tom37 | 23..182 | CDD:371142 | 35/163 (21%) |
GST_C_Metaxin1_3 | 144..280 | CDD:198321 | 36/141 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D422112at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2657 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.950 |