DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8004 and mtx3

DIOPT Version :9

Sequence 1:NP_649161.1 Gene:CG8004 / 40178 FlyBaseID:FBgn0036920 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_002940246.1 Gene:mtx3 / 100493350 XenbaseID:XB-GENE-994127 Length:326 Species:Xenopus tropicalis


Alignment Length:233 Identity:57/233 - (24%)
Similarity:101/233 - (43%) Gaps:14/233 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LPE-NASCLAVKAYLKMCNLPFLIRSCANAEHMSPGGRMTKLPFIRAGAFIFAEFEPIVNFVEQK 100
            ||. :..||.|.||.:....|..: :..:....||.|   .:|.:.:.....::...|:||:.::
 Frog    35 LPSVHPECLVVLAYARFAGAPLKV-TPIDYTWASPKG---TVPLLTSAGEDISQPANILNFLRKQ 95

  Fly   101 ELAIGSWQDEDEKADMRTYVSLVENIFTMAELYISFKNERVYKEVTAPRNGVVFPWPLNHMQNYG 165
            :..........|.:|...|::|:|.....|.|:..:.:...|..||.|......|:|||:.....
 Frog    96 KYNADYVLSAKEGSDTLAYIALLEEKLLPAVLHTFWVDTDNYCSVTRPWYASRTPFPLNYYLPGR 160

  Fly   166 KRRNALRLLKVYQWDD-----LDIDSVIDKVAK-CCETLEYKLKESPETPFFYGDQPCELDAIAF 224
            ..|:||..:.|.:...     .::::.:.|.|| |...:..:|..:   .:|:|..|..|||..|
 Frog   161 MSRDALNRILVTKGQPPLYCLTEVEAQLYKDAKECLNLISNRLGTA---QYFFGSTPTSLDAFVF 222

  Fly   225 GHLFSILTTTLPNMALAQTVQKFQHLVEFCRFVDEKYF 262
            |.|..:....||.:.|.|.:::..:|..||..:...||
 Frog   223 GFLAPLYKAHLPKVNLQQHLKQLSNLCHFCDHILSTYF 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8004NP_649161.1 GST_N_Metaxin2 24..100 CDD:239377 15/63 (24%)
GST_C_Metaxin2 130..258 CDD:198320 35/133 (26%)
mtx3XP_002940246.1 Tom37 42..161 CDD:371142 28/122 (23%)
GST_C_Metaxin1_3 124..260 CDD:198321 35/138 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422112at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2657
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.