DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8004 and wdr86

DIOPT Version :9

Sequence 1:NP_649161.1 Gene:CG8004 / 40178 FlyBaseID:FBgn0036920 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_002932539.2 Gene:wdr86 / 100486668 XenbaseID:XB-GENE-981853 Length:415 Species:Xenopus tropicalis


Alignment Length:185 Identity:31/185 - (16%)
Similarity:55/185 - (29%) Gaps:35/185 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 FAEFEPIVNFVEQKELAIGSWQDEDEKADM--RTYVSLVENIFTMAELYISFKNERVYKEVTAPR 149
            |...|....|....:..:..|:....:..|  ..:.|:|..|........|...:|..:...|..
 Frog    84 FCHLENEAAFTCSADQTVRKWEVSSGECVMVYTGHTSIVNRILVAKGYIFSGSYDRTARSWNADS 148

  Fly   150 NGVVFPWPLNHMQNYGKRRNALRLLKVYQWDDLDIDSVIDKVAKCCETLEYKLKESPE--TPFFY 212
            .        ..:|.:...||.  :|.:..:...|:...:|...|  |..|:.:..|.:  ...:.
 Frog   149 G--------QSLQEFRGHRNC--VLTLAHFSSYDVLEALDVEEK--EVKEFLVTGSTDCTIKIWE 201

  Fly   213 GDQPCELDAIAFGHLFSILTTTLP------------------NMALAQTVQKFQH 249
            ....|....:. ||:.:||...|.                  ||.....:..|:|
 Frog   202 ASSGCCYQTLR-GHVGAILCVVLDTSNGELYSGSMDCTIRRWNMVTGDQLTVFRH 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8004NP_649161.1 GST_N_Metaxin2 24..100 CDD:239377 3/12 (25%)
GST_C_Metaxin2 130..258 CDD:198320 23/140 (16%)
wdr86XP_002932539.2 WD40 29..320 CDD:238121 31/185 (17%)
WD40 repeat 41..77 CDD:293791
WD40 repeat 123..157 CDD:293791 5/41 (12%)
WD40 repeat 162..212 CDD:293791 8/51 (16%)
WD40 repeat 219..254 CDD:293791 4/34 (12%)
WD40 repeat 260..294 CDD:293791
WD40 repeat 300..333 CDD:293791
WD40 326..363 CDD:197651
WD40 repeat 340..362 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.