DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8004 and faxc

DIOPT Version :9

Sequence 1:NP_649161.1 Gene:CG8004 / 40178 FlyBaseID:FBgn0036920 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_002934913.3 Gene:faxc / 100485486 XenbaseID:XB-GENE-985851 Length:406 Species:Xenopus tropicalis


Alignment Length:272 Identity:56/272 - (20%)
Similarity:115/272 - (42%) Gaps:36/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YLSQLITADKLSAEPWPEDATLYQPYEAEQILLPE-NASCLAVKAYLKMCNLPFLIRSCANAEHM 68
            ||...:.|.:...|...:||.:...:......:|. :..||.::.||:|.:||:  ::..:.: :
 Frog    79 YLLHELLAIRKEQEVNSKDAIILHQFSRPNNGVPSLSPFCLKIETYLRMADLPY--QNYFDGK-L 140

  Fly    69 SPGGRMTKLPFIRAGAFIFAEFEPIVNFVEQK-ELAIGSWQDEDEKADMRTYVSLVENIFTMAEL 132
            ||.|   |:|:|.......:..|.|::|:|:| .:.:....:..::|..|....:||..|.....
 Frog   141 SPQG---KMPWIEYNHTRVSGTEFIIDFLEEKLGVNLNKHLNPHQRAVSRAVTKMVEEHFYWTLA 202

  Fly   133 YISFKN--ERVYK--EVTAPRNGVVFPWPLNHM-------QNYGKRRNALRLLKVYQWDDLDIDS 186
            |..:..  :...|  .:|.|.:.:: .|.|.|:       :.||:........::|:..:.|:.|
 Frog   203 YCQWVENLDETQKMLNITGPLSDLL-KWILCHLTKGIVKREMYGQGIGRFSEEEIYRLMEKDMRS 266

  Fly   187 VIDKVAKCCETLEYKLKESPETPFFYGDQPCELDAIAFGHLFSILTTTLPNMALAQTVQ-KFQHL 250
            :...:.              :..:..|.:...|||..||||...: .|||.....:.:: :..:|
 Frog   267 LAGLLG--------------DKKYLMGPKFSTLDATVFGHLAQAM-WTLPGTRPERLIKGELINL 316

  Fly   251 VEFCRFVDEKYF 262
            ..:|..:..|::
 Frog   317 AMYCERIRRKFW 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8004NP_649161.1 GST_N_Metaxin2 24..100 CDD:239377 19/76 (25%)
GST_C_Metaxin2 130..258 CDD:198320 25/139 (18%)
faxcXP_002934913.3 GST_N_4 116..208 CDD:407300 24/97 (25%)
GST_C_6 260..323 CDD:407299 15/77 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.