DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn6 and YKE2

DIOPT Version :9

Sequence 1:NP_001262079.1 Gene:Pfdn6 / 40176 FlyBaseID:FBgn0036918 Length:125 Species:Drosophila melanogaster
Sequence 2:NP_013301.1 Gene:YKE2 / 850897 SGDID:S000004190 Length:114 Species:Saccharomyces cerevisiae


Alignment Length:101 Identity:38/101 - (37%)
Similarity:54/101 - (53%) Gaps:7/101 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YQNLQKSCLKMVKQRAVLESQLNENKCVLDELNLLGPDNKVYKLFGPVLVKQELEESRQNVGKRI 83
            ||.||....:.:..|..||:||.|||.|.:|.:.|..|..||||.|.||:..|..|:|.||.||:
Yeast     8 YQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVEQSEARTNVDKRL 72

  Fly    84 EYI-------SKELKSSTDALENMEKDMLKHRESVA 112
            |:|       .|.::...:.||.|..:::|...:.|
Yeast    73 EFIETEITRCEKNIRDKQEELEKMRSELIKLNNTAA 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn6NP_001262079.1 Prefoldin_beta 12..116 CDD:238345 38/101 (38%)
YKE2NP_013301.1 Prefoldin_beta 1..105 CDD:238345 37/96 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343933
Domainoid 1 1.000 66 1.000 Domainoid score I2388
eggNOG 1 0.900 - - E1_COG1382
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I1731
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54195
OrthoFinder 1 1.000 - - FOG0005240
OrthoInspector 1 1.000 - - oto99547
orthoMCL 1 0.900 - - OOG6_102523
Panther 1 1.100 - - LDO PTHR21431
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R909
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.790

Return to query results.
Submit another query.