DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn6 and PFD6

DIOPT Version :9

Sequence 1:NP_001262079.1 Gene:Pfdn6 / 40176 FlyBaseID:FBgn0036918 Length:125 Species:Drosophila melanogaster
Sequence 2:NP_174292.2 Gene:PFD6 / 839878 AraportID:AT1G29990 Length:129 Species:Arabidopsis thaliana


Alignment Length:123 Identity:54/123 - (43%)
Similarity:73/123 - (59%) Gaps:4/123 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SAALYKKMQAEIESYQN----LQKSCLKMVKQRAVLESQLNENKCVLDELNLLGPDNKVYKLFGP 65
            |::..:.:|.::|:..|    :||...|..:.|.....||.||:.||.||:||..|..||||.||
plant     2 SSSTVRDLQRDLENKANDLGKIQKDIGKNHQLRKKYTIQLGENELVLKELDLLEEDANVYKLIGP 66

  Fly    66 VLVKQELEESRQNVGKRIEYISKELKSSTDALENMEKDMLKHRESVAKYQQQCQVAAA 123
            |||||:|.|:..||.|||||||.|||.....|::||:.....||::.|.||:.|...|
plant    67 VLVKQDLAEANANVRKRIEYISAELKRLDAILQDMEEKQNNKRETIMKLQQRLQTIQA 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn6NP_001262079.1 Prefoldin_beta 12..116 CDD:238345 49/107 (46%)
PFD6NP_174292.2 Prefoldin_beta 13..117 CDD:238345 48/103 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 83 1.000 Domainoid score I2894
eggNOG 1 0.900 - - E1_COG1382
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40720
Inparanoid 1 1.050 89 1.000 Inparanoid score I2292
OMA 1 1.010 - - QHG54195
OrthoDB 1 1.010 - - D1559044at2759
OrthoFinder 1 1.000 - - FOG0005240
OrthoInspector 1 1.000 - - oto4053
orthoMCL 1 0.900 - - OOG6_102523
Panther 1 1.100 - - LDO PTHR21431
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4857
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.