DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn6 and PDF2

DIOPT Version :9

Sequence 1:NP_001262079.1 Gene:Pfdn6 / 40176 FlyBaseID:FBgn0036918 Length:125 Species:Drosophila melanogaster
Sequence 2:NP_188887.1 Gene:PDF2 / 821819 AraportID:AT3G22480 Length:148 Species:Arabidopsis thaliana


Alignment Length:103 Identity:24/103 - (23%)
Similarity:52/103 - (50%) Gaps:3/103 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QAEIESYQNLQKSCLKMVKQRAVLESQLNENKCVLDELNLLGPDNKVYKLFGPVLVKQELEESRQ 77
            ||.:..|:..:....::......||.|::|:..|::.:..|....|.:::.|.|||::.::|...
plant    17 QAVLNMYEGKRSELSQIYSNITDLEMQVSEHSLVINAIQPLDQSRKCFRMIGGVLVERTIKEVLP 81

  Fly    78 NVGKRIEYISKELKSSTDALENMEKDMLKHRESVAKYQ 115
            .|.:..:.:.:.::...:.||..:||:   .|..|||:
plant    82 AVQRNKDGLEEVVRKLYETLEKKKKDL---TEFEAKYK 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn6NP_001262079.1 Prefoldin_beta 12..116 CDD:238345 24/103 (23%)
PDF2NP_188887.1 Prefoldin_2 20..121 CDD:396482 22/100 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.