DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn6 and pfdn6

DIOPT Version :9

Sequence 1:NP_001262079.1 Gene:Pfdn6 / 40176 FlyBaseID:FBgn0036918 Length:125 Species:Drosophila melanogaster
Sequence 2:NP_001015908.1 Gene:pfdn6 / 548662 XenbaseID:XB-GENE-489365 Length:126 Species:Xenopus tropicalis


Alignment Length:112 Identity:53/112 - (47%)
Similarity:70/112 - (62%) Gaps:0/112 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYKKMQAEIESYQNLQKSCLKMVKQRAVLESQLNENKCVLDELNLLGPDNKVYKLFGPVLVKQEL 72
            |.:|:|:||..||.|||.....:..|..||:||.||..|..||..|...|.||||.|||||||:|
 Frog     5 LQEKLQSEINKYQQLQKEISNTMSARQKLEAQLTENNIVKQELAFLDDSNTVYKLIGPVLVKQDL 69

  Fly    73 EESRQNVGKRIEYISKELKSSTDALENMEKDMLKHRESVAKYQQQCQ 119
            ||::..|.||::||:.|:|.....|::||:...:||.|:.|.||..|
 Frog    70 EEAKSTVDKRLQYINGEIKRYETTLKDMEQRSEQHRASLTKLQQDYQ 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn6NP_001262079.1 Prefoldin_beta 12..116 CDD:238345 48/103 (47%)
pfdn6NP_001015908.1 Prefoldin_beta 9..113 CDD:238345 48/103 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 95 1.000 Domainoid score I7314
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40720
Inparanoid 1 1.050 100 1.000 Inparanoid score I4861
OMA 1 1.010 - - QHG54195
OrthoDB 1 1.010 - - D1559044at2759
OrthoFinder 1 1.000 - - FOG0005240
OrthoInspector 1 1.000 - - oto103619
Panther 1 1.100 - - LDO PTHR21431
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R909
SonicParanoid 1 1.000 - - X4857
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.