DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn6 and pfdn6

DIOPT Version :9

Sequence 1:NP_001262079.1 Gene:Pfdn6 / 40176 FlyBaseID:FBgn0036918 Length:125 Species:Drosophila melanogaster
Sequence 2:NP_956807.1 Gene:pfdn6 / 393485 ZFINID:ZDB-GENE-040426-1589 Length:126 Species:Danio rerio


Alignment Length:115 Identity:57/115 - (49%)
Similarity:77/115 - (66%) Gaps:0/115 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ALYKKMQAEIESYQNLQKSCLKMVKQRAVLESQLNENKCVLDELNLLGPDNKVYKLFGPVLVKQE 71
            |:.||:|||:|.||.|||...|.:..|..||:||.||..|.:||.||...|.||||.|||||||:
Zfish     4 AIQKKLQAELEKYQQLQKDVSKSMSARQKLEAQLTENNIVKEELALLDSQNTVYKLIGPVLVKQD 68

  Fly    72 LEESRQNVGKRIEYISKELKSSTDALENMEKDMLKHRESVAKYQQQCQVA 121
            |:|::..||||:|||:.|::.....|:.||:...:|||.::..||:.|.|
Zfish    69 LDEAKATVGKRLEYINGEIQRYETLLKEMERKSEQHREVLSSLQQEYQRA 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn6NP_001262079.1 Prefoldin_beta 12..116 CDD:238345 50/103 (49%)
pfdn6NP_956807.1 Prefoldin_beta 9..113 CDD:238345 50/103 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581407
Domainoid 1 1.000 102 1.000 Domainoid score I6854
eggNOG 1 0.900 - - E1_COG1382
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40720
Inparanoid 1 1.050 109 1.000 Inparanoid score I4874
OMA 1 1.010 - - QHG54195
OrthoDB 1 1.010 - - D1559044at2759
OrthoFinder 1 1.000 - - FOG0005240
OrthoInspector 1 1.000 - - oto41601
orthoMCL 1 0.900 - - OOG6_102523
Panther 1 1.100 - - LDO PTHR21431
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R909
SonicParanoid 1 1.000 - - X4857
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.