DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn6 and SPAC3A11.13

DIOPT Version :9

Sequence 1:NP_001262079.1 Gene:Pfdn6 / 40176 FlyBaseID:FBgn0036918 Length:125 Species:Drosophila melanogaster
Sequence 2:NP_594190.1 Gene:SPAC3A11.13 / 2543106 PomBaseID:SPAC3A11.13 Length:114 Species:Schizosaccharomyces pombe


Alignment Length:112 Identity:45/112 - (40%)
Similarity:61/112 - (54%) Gaps:4/112 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MQAEIESYQNLQKSCLKMVKQRAVLESQLNENKCVLDELNLLGPDNKVYKLFGPVLVKQELEESR 76
            |:...:.|||||......|:....||:||.||..||:||..:.||:.:||..||.||||..||::
pombe     1 MEELAKKYQNLQTELSTYVESLKKLETQLQENTTVLNELEKVAPDSNIYKQIGPTLVKQSHEEAK 65

  Fly    77 QNVGKRIEYISKELKSSTDALENMEKDMLKHRESVAKYQQQCQVAAA 123
            .||..|:::|:||:.    .|||..|...:....|.....|.|.|||
pombe    66 TNVKTRLDFINKEIA----RLENQTKISQEEFSKVKGAIIQAQAAAA 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn6NP_001262079.1 Prefoldin_beta 12..116 CDD:238345 40/103 (39%)
SPAC3A11.13NP_594190.1 Prefoldin_beta 1..98 CDD:238345 40/100 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I2628
eggNOG 1 0.900 - - E1_COG1382
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I1899
OMA 1 1.010 - - QHG54195
OrthoFinder 1 1.000 - - FOG0005240
OrthoInspector 1 1.000 - - oto101171
orthoMCL 1 0.900 - - OOG6_102523
Panther 1 1.100 - - LDO PTHR21431
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R909
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.