DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn6 and SPAC227.10

DIOPT Version :9

Sequence 1:NP_001262079.1 Gene:Pfdn6 / 40176 FlyBaseID:FBgn0036918 Length:125 Species:Drosophila melanogaster
Sequence 2:NP_592964.1 Gene:SPAC227.10 / 2541498 PomBaseID:SPAC227.10 Length:114 Species:Schizosaccharomyces pombe


Alignment Length:107 Identity:26/107 - (24%)
Similarity:57/107 - (53%) Gaps:17/107 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MQAEIESYQNLQKSCLKMVKQRAV-LESQLNENKCVLDELNLLGPDNKVYKLFGPVLVKQELEES 75
            :|.:..||    ||.|:.:.|:.| ||:..:|:|.|:|.||.:..:.:.:::...|||:      
pombe    11 LQTQYNSY----KSRLQQIAQKIVDLETDADEHKLVMDTLNSMDNNRRCFRMIHGVLVE------ 65

  Fly    76 RQNVGKRIEYISKELKSSTDALENMEKDML-KHRESVAKYQQ 116
             :.||..:..    ||::.:.::.....:| ::::..|::|:
pombe    66 -RTVGTVVPI----LKTTQEGIQTAMNGLLDQYKQLEAEFQK 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn6NP_001262079.1 Prefoldin_beta 12..116 CDD:238345 25/105 (24%)
SPAC227.10NP_592964.1 Prefoldin_2 9..111 CDD:280154 26/107 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.