DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn6 and pfd-6

DIOPT Version :9

Sequence 1:NP_001262079.1 Gene:Pfdn6 / 40176 FlyBaseID:FBgn0036918 Length:125 Species:Drosophila melanogaster
Sequence 2:NP_492058.1 Gene:pfd-6 / 172474 WormBaseID:WBGene00009004 Length:126 Species:Caenorhabditis elegans


Alignment Length:119 Identity:44/119 - (36%)
Similarity:66/119 - (55%) Gaps:4/119 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KMQAEIESYQNLQKSCLKMVKQRAVLESQLNENKCVLDELNLLGPDNKVYKLFGPVLVKQELEES 75
            |.:.|:...:.|:|...|....|..:|.:|.|:|.|..||:|:..|:|||||.|.|||:|:|||:
 Worm     6 KFEEEVNKLRTLEKDREKYFTSRQEMEMRLTESKNVKAELDLMESDSKVYKLIGAVLVRQDLEEA 70

  Fly    76 RQNVGKRIEYISKELKSSTDALENMEKDMLKHRESV----AKYQQQCQVAAAMQ 125
            |..|.||:|:|..|.|....::.::.|...:.|:.|    ..:|...|.||..|
 Worm    71 RSTVEKRLEFIDSETKRVEASISDISKKCTEQRDKVMNMQKSFQMMAQAAAQAQ 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn6NP_001262079.1 Prefoldin_beta 12..116 CDD:238345 38/107 (36%)
pfd-6NP_492058.1 Prefoldin_beta 7..111 CDD:238345 38/103 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159598
Domainoid 1 1.000 74 1.000 Domainoid score I5967
eggNOG 1 0.900 - - E1_COG1382
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I3808
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54195
OrthoDB 1 1.010 - - D1559044at2759
OrthoFinder 1 1.000 - - FOG0005240
OrthoInspector 1 1.000 - - oto18541
orthoMCL 1 0.900 - - OOG6_102523
Panther 1 1.100 - - LDO PTHR21431
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R909
SonicParanoid 1 1.000 - - X4857
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.