DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn6 and PFDN6

DIOPT Version :9

Sequence 1:NP_001262079.1 Gene:Pfdn6 / 40176 FlyBaseID:FBgn0036918 Length:125 Species:Drosophila melanogaster
Sequence 2:NP_001172110.1 Gene:PFDN6 / 10471 HGNCID:4926 Length:129 Species:Homo sapiens


Alignment Length:116 Identity:56/116 - (48%)
Similarity:76/116 - (65%) Gaps:0/116 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYKKMQAEIESYQNLQKSCLKMVKQRAVLESQLNENKCVLDELNLLGPDNKVYKLFGPVLVKQEL 72
            :.||:|.|:|.||.|||...|.:..|..||:||.||..|.:||.||...|.|:||.|||||||||
Human     5 IQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQEL 69

  Fly    73 EESRQNVGKRIEYISKELKSSTDALENMEKDMLKHRESVAKYQQQCQVAAA 123
            .|:|..||||::||:.|:|.....|.::|:...:.||::|:.||:.|.|.|
Human    70 GEARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQA 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn6NP_001262079.1 Prefoldin_beta 12..116 CDD:238345 49/103 (48%)
PFDN6NP_001172110.1 Prefoldin_beta 9..113 CDD:238345 49/103 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147605
Domainoid 1 1.000 99 1.000 Domainoid score I7105
eggNOG 1 0.900 - - E1_COG1382
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40720
Inparanoid 1 1.050 106 1.000 Inparanoid score I4943
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54195
OrthoDB 1 1.010 - - D1559044at2759
OrthoFinder 1 1.000 - - FOG0005240
OrthoInspector 1 1.000 - - oto89812
orthoMCL 1 0.900 - - OOG6_102523
Panther 1 1.100 - - LDO PTHR21431
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R909
SonicParanoid 1 1.000 - - X4857
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.