DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtr3 and RRP46

DIOPT Version :9

Sequence 1:NP_649157.1 Gene:Mtr3 / 40173 FlyBaseID:FBgn0036916 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_011609.2 Gene:RRP46 / 852987 SGDID:S000003327 Length:223 Species:Saccharomyces cerevisiae


Alignment Length:290 Identity:61/290 - (21%)
Similarity:97/290 - (33%) Gaps:107/290 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GVLTTVRGSAYMEYGNTKVLAIVAPPKELIRASAR-------------RMNMGVLNCYVNFAAFS 106
            |:|..|.||:.....:|||:..|..|   |...||             |...||           
Yeast     8 GILDHVDGSSEFVSQDTKVICSVTGP---IEPKARQELPTQLALEIIVRPAKGV----------- 58

  Fly   107 TGDLDSVPERERHLSSMLTKAMEPVVCRTEFLN--FQLDIRVLILDDDGC-----LLSTAINCCG 164
                  ...||:.|...|...:.|::.|..:..  .|:..::|...:|..     .||..||...
Yeast    59 ------ATTREKVLEDKLRAVLTPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAF 117

  Fly   165 VALVECGISTYDLITASTACIYRDHVFLNPSAKVEELLWKHRNSSTDSTTSPSSAQEHGLIITAS 229
            :|||:.||:...:..:....|.:|                    ::|....|             
Yeast   118 LALVDAGIALNSMCASIPIAIIKD--------------------TSDIIVDP------------- 149

  Fly   230 MDTFEQIAQCQQCGYLSPATYVKLLDYTLAINKSLRELVKGVLTKRVKEQHELDL-----REKAE 289
              |.||:.             :.|..:|||:     |.|.|  .|.||....||.     .::..
Yeast   150 --TAEQLK-------------ISLSVHTLAL-----EFVNG--GKVVKNVLLLDSNGDFNEDQLF 192

  Fly   290 TALE--DQRLEEIIEKLKKQGPEEFIQSNI 317
            :.||  :|:.:|::..:::     .||.||
Yeast   193 SLLELGEQKCQELVTNIRR-----IIQDNI 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mtr3NP_649157.1 RNase_PH 47..274 CDD:295670 48/238 (20%)
RRP46NP_011609.2 RNase_PH_RRP46 4..210 CDD:206777 57/276 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53663
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.