DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtr3 and RRP41

DIOPT Version :9

Sequence 1:NP_649157.1 Gene:Mtr3 / 40173 FlyBaseID:FBgn0036916 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001118878.1 Gene:RRP41 / 825335 AraportID:AT3G61620 Length:241 Species:Arabidopsis thaliana


Alignment Length:250 Identity:68/250 - (27%)
Similarity:106/250 - (42%) Gaps:37/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RNTFIRAGVLTTVRGSAYMEYGNTKVLAIVAPPKELIRASARRMN-MGVLNCYVNFAAFSTGD-- 109
            |......||::...|||..|.|||||:|.|..|:|:...|.::.| ..|:.|..:.|.|||||  
plant    20 RQIVAEVGVVSKADGSAVFEMGNTKVIAAVYGPREIQNKSQQKKNDHAVVLCEYSMAQFSTGDRR 84

  Fly   110 LDSVPERERHLSSMLTKAMEPVVCRTEFLNFQLDIRVLILDDDGCLLSTAINCCGVALVECGIST 174
            ......|...||.::.:.||..:......:.|:||.:.:|..||...|..||...:||.:.||..
plant    85 RQKFDRRSTELSLVIRQTMEACILTELMPHSQIDIFLQVLQADGGTRSACINAATLALADAGIPM 149

  Fly   175 YDLITASTACIYRDHVFLNPSAKVEELLWKHRNSSTDSTTS--PSSAQEHGLIITAS--MDTFEQ 235
            .||..:.:|      .:||.:..::....:......|.|..  |...:...|.:.|.  |:|||.
plant   150 RDLAVSCSA------GYLNSTPLLDLNYVEDSAGGADVTVGILPKLDKVSLLQMDAKLPMETFET 208

  Fly   236 IAQCQQCGYLSPATYVKLLDYTLAIN--KSLRELVKGVLTKRVKEQHELDLREKA 288
            :                   :.||..  |::.|.::.||.:..|   :|:.|..|
plant   209 V-------------------FALASEGCKAIAERIREVLQENTK---QLEYRRAA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mtr3NP_649157.1 RNase_PH 47..274 CDD:295670 64/234 (27%)
RRP41NP_001118878.1 RNase_PH_RRP41 8..233 CDD:206775 64/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0689
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53663
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001991
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.