DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtr3 and Exosc6

DIOPT Version :9

Sequence 1:NP_649157.1 Gene:Mtr3 / 40173 FlyBaseID:FBgn0036916 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_082550.1 Gene:Exosc6 / 72544 MGIID:1919794 Length:273 Species:Mus musculus


Alignment Length:233 Identity:69/233 - (29%)
Similarity:102/233 - (43%) Gaps:39/233 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQESE--DFFESLD---KPSREPTQLAPRNTFIRAGVLTTVRGSAYMEYGNTKVLAIVAPPKEL- 83
            |:||:  ..:.:.|   ..:|:||:|.|  .:.|||:|:..:||||:|.|.||||..|:.|::. 
Mouse    11 PEESQPPQLYAAEDDETPAARDPTRLRP--VYARAGLLSQAKGSAYLEAGGTKVLCAVSGPRQAE 73

  Fly    84 ----------IRASARRMNMGVLNCYVNFAAFSTGDLDSVPE----RERHLSSMLTKAMEPVVCR 134
                      ....|.....|.|.|....|.|| |.....|:    .:|.|...|.:|:||.|..
Mouse    74 GGERGSGPAGAGGEAPAALRGRLLCDFRRAPFS-GRRRRAPQGGGGEDRELGLALQEALEPAVRL 137

  Fly   135 TEFLNFQLDIRVLILDDDGCLLSTAINCCGVALVECGISTYDLITASTACIYRDHVFLNPSAKVE 199
            ..:...||::..|:|:|.||.|:.|:....:||.:.|:..|||:   ..|    .:.|.|.....
Mouse   138 GRYPRAQLEVSALLLEDGGCALAAALTAAALALADAGVEMYDLV---VGC----GLSLTPGPSPT 195

  Fly   200 ELLWKHRNSSTDSTTSPSSAQEHGLIITASMDTFEQIA 237
            .||        |.|.........||.: |.|....|:|
Mouse   196 WLL--------DPTRLEEEHSAAGLTV-ALMPVLNQVA 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mtr3NP_649157.1 RNase_PH 47..274 CDD:295670 61/206 (30%)
Exosc6NP_082550.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 7/24 (29%)
Rph 28..260 CDD:223761 65/216 (30%)
RNase_PH_MTR3 36..261 CDD:206776 62/208 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842486
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53663
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102545
Panther 1 1.100 - - LDO PTHR11953
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R763
SonicParanoid 1 1.000 - - X4850
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.