Sequence 1: | NP_649157.1 | Gene: | Mtr3 / 40173 | FlyBaseID: | FBgn0036916 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_064543.3 | Gene: | EXOSC5 / 56915 | HGNCID: | 24662 | Length: | 235 | Species: | Homo sapiens |
Alignment Length: | 200 | Identity: | 45/200 - (22%) |
---|---|---|---|
Similarity: | 77/200 - (38%) | Gaps: | 40/200 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 VLTTVRGSAYMEYGNTKVLAIVAPPKELIRASARRMNMGVLNCYVNFAAFSTGDLDSVPERERHL 120
Fly 121 SSMLTKAMEPVVCRTEFLNFQLDIRVLILDDDGCLLSTAINCCGVALVECGISTYDLITASTACI 185
Fly 186 YRD-HVFLNPSAKVEELLWKHRNSSTDSTTSPSSAQEHGLIITASMDTFEQ------------IA 237
Fly 238 QCQQC 242 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Mtr3 | NP_649157.1 | RNase_PH | 47..274 | CDD:295670 | 44/199 (22%) |
EXOSC5 | NP_064543.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..24 | ||
ECX1 | 28..232 | CDD:131120 | 44/199 (22%) | ||
RNase_PH_RRP46 | 28..225 | CDD:206777 | 44/199 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0689 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG53663 | |
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |