DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtr3 and exosc6

DIOPT Version :9

Sequence 1:NP_649157.1 Gene:Mtr3 / 40173 FlyBaseID:FBgn0036916 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001017016.1 Gene:exosc6 / 549770 XenbaseID:XB-GENE-998313 Length:270 Species:Xenopus tropicalis


Alignment Length:249 Identity:72/249 - (28%)
Similarity:117/249 - (46%) Gaps:32/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SEDFFESLDKPSREPTQLAPRNTFIRAGVLTTVRGSAYMEYGN--TKVLAIVAPPKELIRASARR 90
            ||:..::..:..|.|::  ||..|:|||:|:..:||||:|.|:  ||||..|..|:|......|.
 Frog    23 SEEGGKAAGRRGRGPSE--PRPVFVRAGLLSQAKGSAYLEAGSGGTKVLCAVHGPRERGMGGERA 85

  Fly    91 MNMGVLNCYVNFAAFS-----TGDLDSVPERERHLSSMLTKAMEPVVCRTEFLNFQLDIRVLILD 150
            ...|.|.|.:.:|.||     :|...:.|. .|.....|.:::||.|....:...::.:.||:|:
 Frog    86 ETRGRLLCDLRWAPFSRRGPWSGSCPAGPS-PRQAGLQLQESLEPAVRLDRYPRAEVIVWVLVLE 149

  Fly   151 DDGCLLSTAINCCGVALVECGISTYDLITASTAC-IYR---DHVFLNPSAKVEELLWKHRNSSTD 211
            |.|..|..|::|..:||.:.||..:||   :..| :.|   ..:.|:|....||       :.:.
 Frog   150 DRGSALPAAVSCASLALADAGIEMFDL---ALGCGLSRGPGGELLLDPDDDEEE-------AGSG 204

  Fly   212 STTS----PSSAQEHGLIITASMD---TFEQIAQCQQ-CGYLSPATYVKLLDYT 257
            .|.|    |:..|..|||.:...:   :.|.:..|.: |..|.|..:..|:..|
 Frog   205 GTMSLSLLPTLNQVSGLISSGEWEGESSEEAVRLCMEGCQRLYPVLHQCLVKAT 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mtr3NP_649157.1 RNase_PH 47..274 CDD:295670 68/230 (30%)
exosc6NP_001017016.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..42 5/20 (25%)
RNase_PH_MTR3 40..256 CDD:206776 67/226 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53663
OrthoDB 1 1.010 - - D1101132at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11953
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R763
SonicParanoid 1 1.000 - - X4850
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.