DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtr3 and exosc4

DIOPT Version :9

Sequence 1:NP_649157.1 Gene:Mtr3 / 40173 FlyBaseID:FBgn0036916 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001016436.1 Gene:exosc4 / 549190 XenbaseID:XB-GENE-969649 Length:249 Species:Xenopus tropicalis


Alignment Length:260 Identity:75/260 - (28%)
Similarity:109/260 - (41%) Gaps:56/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RAGVLTTVRGSAYMEYGNTKVLAIVAPPKELIRASARRM--NMGVLNCYVNFAAFSTGDLDSVPE 115
            |.||.....||||:|.||||.||:|..|.| ||.|..:|  :..|:||..:.|.||||:....|.
 Frog    28 RMGVFAQADGSAYIEQGNTKALAVVYGPHE-IRGSRSKMLHDRSVVNCQYSMATFSTGERKRRPH 91

  Fly   116 RERHLSSM---LTKAMEPVVCRTEFLNFQLDIRVLILDDDGCLLSTAINCCGVALVECGISTYDL 177
            .:|..|.|   |.:..|..:....:...|:||.|.||..||....|.:|...:|:::.||...|.
 Frog    92 GDRKSSEMTLHLKQTFEAAILTQLYPRSQIDIYVQILQADGGNYCTCVNAATLAVIDAGIPMRDY 156

  Fly   178 ITASTACIYRDHVFLNPSAK---VEELLWKHRNSSTDSTTSPSSAQEHGLIITASMDTFEQIAQC 239
            :.||:|....|    .|.|.   |||           :...|..|       .|.:...:|||  
 Frog   157 VCASSAGFIED----TPLADLSYVEE-----------AAGGPQLA-------LALLPKSDQIA-- 197

  Fly   240 QQCGYLSPATYVKLLDYTLAINKSLRELVKGVLTKRVKEQHELDLREKAETALEDQRLEEIIEKL 304
                         ||:....:::...|.|....:|..|:.:          |:.||.:.|.:::|
 Frog   198 -------------LLEMNSRLHEDHLERVMDAASKACKDVY----------AVLDQVVREHLQEL 239

  Fly   305  304
             Frog   240  239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mtr3NP_649157.1 RNase_PH 47..274 CDD:295670 68/228 (30%)
exosc4NP_001016436.1 RNase_PH_RRP41 11..237 CDD:206775 74/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001991
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.