DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtr3 and EXOSC4

DIOPT Version :9

Sequence 1:NP_649157.1 Gene:Mtr3 / 40173 FlyBaseID:FBgn0036916 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_061910.1 Gene:EXOSC4 / 54512 HGNCID:18189 Length:245 Species:Homo sapiens


Alignment Length:230 Identity:62/230 - (26%)
Similarity:99/230 - (43%) Gaps:23/230 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RAGVLTTVRGSAYMEYGNTKVLAIVAPPKELIRASARRM-NMGVLNCYVNFAAFSTGDLDSVPER 116
            |.||.....||||:|.||||.||:|..|.|:..:.||.: :..::||..:.|.||||:....|..
Human    28 RMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRALVNCQYSSATFSTGERKRRPHG 92

  Fly   117 ERHLSSM---LTKAMEPVVCRTEFLNFQLDIRVLILDDDGCLLSTAINCCGVALVECGISTYDLI 178
            :|....|   |.:..|..:........|:||.|.:|..||...:..:|...:|:::.||...|.:
Human    93 DRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVLDAGIPMRDFV 157

  Fly   179 TASTACIYRDHVFLNPSAKVEELLWKHRNSSTDSTTSPSSAQEHGLIITASMDTFEQIAQCQQCG 243
            .|.:|. :.|...|...:.|||           :...|..|       .|.:....|||..:...
Human   158 CACSAG-FVDGTALADLSHVEE-----------AAGGPQLA-------LALLPASGQIALLEMDA 203

  Fly   244 YLSPATYVKLLDYTLAINKSLRELVKGVLTKRVKE 278
            .|......::|:......:.:..|:..|:.:.|:|
Human   204 RLHEDHLERVLEAAAQAARDVHTLLDRVVRQHVRE 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mtr3NP_649157.1 RNase_PH 47..274 CDD:295670 60/224 (27%)
EXOSC4NP_061910.1 RNase_PH_RRP41 11..237 CDD:206775 60/227 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S936
OMA 1 1.010 - - QHG53663
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001991
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.