DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtr3 and Rrp46

DIOPT Version :9

Sequence 1:NP_649157.1 Gene:Mtr3 / 40173 FlyBaseID:FBgn0036916 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_650001.2 Gene:Rrp46 / 41270 FlyBaseID:FBgn0037815 Length:233 Species:Drosophila melanogaster


Alignment Length:200 Identity:39/200 - (19%)
Similarity:79/200 - (39%) Gaps:14/200 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LTTVRGSAYMEYGNTKVLAIVAPPKELIRASARRMNMGVLNCYVNFAAFSTGDLDSVPERERHLS 121
            |:...||.....|.|.::..|..|.|:     :..|:.:...|:.........|..|.:|.|  .
  Fly    24 LSRCDGSVMYSQGATGLIGAVLGPIEV-----KTQNLSIDGSYLECNYRPKAGLPQVTDRIR--E 81

  Fly   122 SMLTKAMEPVVCRTEFLNFQLDIRVLILDDDGCLLSTAINCCGVALVECGISTYDLITASTACIY 186
            :.:...:|..:........::.:::..|:|.|.:.:.|:||..:|::..|:.......|..|.|.
  Fly    82 AAIRDVLELALLSEAHPRSKMSVQIQELEDRGSIDACAVNCACLAMLIGGLPLKYSFAAVHAIIN 146

  Fly   187 RDHVFLNPSAKVEELLWKHRNSSTDSTTSPSSAQEHGLIITASMDTFEQIAQCQQCGYLSPATYV 251
            ....::....:.|.|   |:.:   |.|....:.|..|::..:..:| :|||......|..|...
  Fly   147 EQGEYVLDPDQSETL---HQRA---SFTFAFDSVEGNLLLIQTKGSF-KIAQFNDIECLCLAASA 204

  Fly   252 KLLDY 256
            ::..:
  Fly   205 EIFQF 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mtr3NP_649157.1 RNase_PH 47..274 CDD:295670 39/199 (20%)
Rrp46NP_650001.2 Rph 10..215 CDD:223761 39/199 (20%)
RNase_PH_RRP46 14..211 CDD:206777 39/199 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456998
Domainoid 1 1.000 43 1.000 Domainoid score I745
eggNOG 1 0.900 - - E1_COG0689
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11953
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.