DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtr3 and Exosc4

DIOPT Version :9

Sequence 1:NP_649157.1 Gene:Mtr3 / 40173 FlyBaseID:FBgn0036916 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001128332.1 Gene:Exosc4 / 300045 RGDID:1310986 Length:245 Species:Rattus norvegicus


Alignment Length:265 Identity:69/265 - (26%)
Similarity:107/265 - (40%) Gaps:60/265 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RAGVLTTVRGSAYMEYGNTKVLAIVAPPKELIRASARRM--NMGVLNCYVNFAAFSTGDLDSVPE 115
            |.||.....||||:|.||||.||:|..|.| ||.|..|.  :..::||..:.|.||||:....|.
  Rat    28 RMGVFAQADGSAYIEQGNTKALAVVYGPHE-IRGSRSRALPDRALVNCQYSSATFSTGERKRRPH 91

  Fly   116 RERHLSSM---LTKAMEPVVCRTEFLNFQLDIRVLILDDDGCLLSTAINCCGVALVECGISTYDL 177
            .:|....|   |.:..|..:........|:||.|.:|..||...:..:|...:|:::.||...|.
  Rat    92 GDRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVMDAGIPMRDF 156

  Fly   178 ITASTACIYRDHVFLNPSAKVEELLWKHRNSSTDSTTSPSSAQEHGLIITASMDTFEQIAQCQQC 242
            :.|.:|. :.|...|...:.|||           :...|                  |:|..   
  Rat   157 VCACSAG-FVDGTALADLSHVEE-----------AAGGP------------------QLALA--- 188

  Fly   243 GYLSPAT-YVKLLDYTLAINKSLRELVKGVLTKRVKEQHELDLREKAETALEDQRLEEIIEKLKK 306
              |.||: .:.||:                :..|:.|.|...:.|.|..|..|  :..:::::.:
  Rat   189 --LLPASGQIALLE----------------MDSRLHEDHLEQVLEAAAQAARD--VHTLLDRVVR 233

  Fly   307 QGPEE 311
            |..:|
  Rat   234 QHVQE 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mtr3NP_649157.1 RNase_PH 47..274 CDD:295670 60/226 (27%)
Exosc4NP_001128332.1 RNase_PH_RRP41 11..237 CDD:206775 68/262 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53663
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001991
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.