DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtr3 and Exosc5

DIOPT Version :9

Sequence 1:NP_649157.1 Gene:Mtr3 / 40173 FlyBaseID:FBgn0036916 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_613052.1 Gene:Exosc5 / 27998 MGIID:107889 Length:235 Species:Mus musculus


Alignment Length:220 Identity:51/220 - (23%)
Similarity:84/220 - (38%) Gaps:47/220 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TQLAPRNTF-------IRAGVLTTVRGSAYMEYGNTKVLAIVAPPKELIRASARRMNMGVLNCYV 100
            |:.:||:..       ....:|:...|||....|:|.|||.|..|.| ::.|....|...|...:
Mouse    17 TESSPRSPVCSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAE-VKVSKEIFNKATLEVIL 80

  Fly   101 NFAAFSTGDLDSVPERERHLSSMLTKAMEPVVCRTEFLNFQLDIRVLILDDDGCLLSTAINCCGV 165
            .    ....|..|.|:.|  ..::....|.||.........:.:.:.::.|.|.||:..:|...:
Mouse    81 R----PKIGLPGVAEKSR--ERLVRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACM 139

  Fly   166 ALVECGISTYDLITASTACIYRD-HVFLNPSAKVEELLWKHRNSSTDSTTSPSSAQEHGLIITAS 229
            |||:.|:....|....|..:..| ::.|:|:.|.|                    :|...|:|.:
Mouse   140 ALVDAGVPMRALFCGVTCALDSDGNLVLDPTTKQE--------------------KEARAILTFA 184

  Fly   230 MDTFEQ------------IAQCQQC 242
            :|:.||            .|:.|||
Mouse   185 LDSAEQKLLMSTTKGLYSDAELQQC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mtr3NP_649157.1 RNase_PH 47..274 CDD:295670 50/216 (23%)
Exosc5NP_613052.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 1/3 (33%)
ECX1 11..232 CDD:131120 51/220 (23%)
RNase_PH_RRP46 28..225 CDD:206777 48/209 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53663
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.