DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtr3 and exos-4.2

DIOPT Version :9

Sequence 1:NP_649157.1 Gene:Mtr3 / 40173 FlyBaseID:FBgn0036916 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001380008.1 Gene:exos-4.2 / 259488 WormBaseID:WBGene00000202 Length:241 Species:Caenorhabditis elegans


Alignment Length:210 Identity:52/210 - (24%)
Similarity:82/210 - (39%) Gaps:42/210 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PYTTPQESEDFFESLDKPSREPTQLAPRNTFIRAGVLTTVRGSAYMEYGNTKVLAIVAPPK---- 81
            |.|.....:|.....|....:....|.|...::.||.....||.|.|:|||:|||.:..|.    
 Worm    11 PLTHLARIDDDRMETDSEEHKRANTAFRPLCVKCGVFGAQDGSGYAEFGNTRVLAQITGPDGDGK 75

  Fly    82 -ELIRASARRMNMGVLNCYVNFAAFSTGDLDSVPERERHLSSMLTKAMEPVVCRTEFLNFQLDIR 145
             |..||.......|:              .|||...|  ..:.|..|:..|:..:::....::|.
 Worm    76 WEEDRAKITIELKGI--------------EDSVKVAE--YRAQLASAVSAVIFASKYPGKVIEIE 124

  Fly   146 VLILDDDGCLLSTAINCCGVALVECGISTYDLITASTACIYRDHVFLNPSAKVEELLWKHRNSST 210
            :.:|.|||.:||||::...:|:...||....|:.:.       ||.:              ||..
 Worm   125 ITVLSDDGGVLSTALSAVTLAISHSGIENMGLMASV-------HVAM--------------NSDG 168

  Fly   211 DSTTSPSSAQEHGLI 225
            :..|.||:::..|.|
 Worm   169 ECLTDPSTSESEGAI 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mtr3NP_649157.1 RNase_PH 47..274 CDD:295670 47/184 (26%)
exos-4.2NP_001380008.1 RNase_PH 37..235 CDD:413593 47/184 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162494
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53663
OrthoDB 1 1.010 - - D1101132at2759
OrthoFinder 1 1.000 - - FOG0001991
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102545
Panther 1 1.100 - - LDO PTHR11953
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.