DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtr3 and exos-4.1

DIOPT Version :9

Sequence 1:NP_649157.1 Gene:Mtr3 / 40173 FlyBaseID:FBgn0036916 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001366781.1 Gene:exos-4.1 / 24105309 WormBaseID:WBGene00007201 Length:240 Species:Caenorhabditis elegans


Alignment Length:151 Identity:48/151 - (31%)
Similarity:70/151 - (46%) Gaps:16/151 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 REPTQLAPRNTFIRAGVLTTVRGSAYMEYGNTKVLAIVAPPKELIRASARRMNMGVLNCYVNFAA 104
            |.|.|:  ||...|.|:.....||.|:|:||||||..|..|.| .::|.|..:...:.|..:...
 Worm    14 RRPAQI--RNINTRLGLNRNAEGSCYLEHGNTKVLCAVYGPYE-GKSSKRIEDKCAIVCQYSATK 75

  Fly   105 FS--------TGDLDSVPERERHLSSMLTKAMEPVVCRTEFLNFQLDIRVLILDDDGCLLSTAIN 161
            ||        .||     .:...:|.:|.||.|.|:....|...||||...::..||..|:..:|
 Worm    76 FSGLERKNRTRGD-----RKSTEISRLLEKAFESVILTEAFPRSQLDIFCEVIQGDGSNLAACVN 135

  Fly   162 CCGVALVECGISTYDLITAST 182
            ...:||.:.||....:.:|:|
 Worm   136 ATSLALADAGIPMKGIASAAT 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mtr3NP_649157.1 RNase_PH 47..274 CDD:295670 45/144 (31%)
exos-4.1NP_001366781.1 RNase_PH_RRP41 8..232 CDD:206775 48/151 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53663
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001991
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.