DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtr3 and EXOSC6

DIOPT Version :9

Sequence 1:NP_649157.1 Gene:Mtr3 / 40173 FlyBaseID:FBgn0036916 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_478126.1 Gene:EXOSC6 / 118460 HGNCID:19055 Length:272 Species:Homo sapiens


Alignment Length:181 Identity:57/181 - (31%)
Similarity:82/181 - (45%) Gaps:33/181 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LDGASIEEEPYTTPQESEDFFESLDKPSREPTQLAPRNTFIRAGVLTTVRGSAYMEYGNTKVLAI 76
            |..|..||.|.|                |:||:|.|  .:.|||:|:..:||||:|.|.||||..
Human    19 LYAADEEEAPGT----------------RDPTRLRP--VYARAGLLSQAKGSAYLEAGGTKVLCA 65

  Fly    77 VAPPKEL-----------IRASARRMNMGVLNCYVNFAAFSTGDLDSVPE---RERHLSSMLTKA 127
            |:.|::.           ....|.....|.|.|....|.|: |.....|.   .||.|:..|.:|
Human    66 VSGPRQAEGGERGGGPAGAGGEAPAALRGRLLCDFRRAPFA-GRRRRAPPGGCEERELALALQEA 129

  Fly   128 MEPVVCRTEFLNFQLDIRVLILDDDGCLLSTAINCCGVALVECGISTYDLI 178
            :||.|....:...||::..|:|:|.|..|:.|:....:||.:.|:..|||:
Human   130 LEPAVRLGRYPRAQLEVSALLLEDGGSALAAALTAAALALADAGVEMYDLV 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mtr3NP_649157.1 RNase_PH 47..274 CDD:295670 47/146 (32%)
EXOSC6NP_478126.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 9/32 (28%)
RNase_PH_MTR3 36..260 CDD:206776 48/148 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152420
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0689
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53663
OrthoDB 1 1.010 - - D1101132at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102545
Panther 1 1.100 - - LDO PTHR11953
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R763
SonicParanoid 1 1.000 - - X4850
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.750

Return to query results.
Submit another query.