DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtr3 and Exosc4

DIOPT Version :9

Sequence 1:NP_649157.1 Gene:Mtr3 / 40173 FlyBaseID:FBgn0036916 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_780608.1 Gene:Exosc4 / 109075 MGIID:1923576 Length:245 Species:Mus musculus


Alignment Length:153 Identity:52/153 - (33%)
Similarity:74/153 - (48%) Gaps:7/153 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RAGVLTTVRGSAYMEYGNTKVLAIVAPPKELIRASARRM--NMGVLNCYVNFAAFSTGDLDSVPE 115
            |.||.....||||:|.||||.||:|..|.| ||.|..|.  :..::||..:.|.||||:....|.
Mouse    28 RMGVFAQADGSAYIEQGNTKALAVVYGPHE-IRGSRSRALPDRALVNCQYSSATFSTGERKRRPH 91

  Fly   116 RERHLSSM---LTKAMEPVVCRTEFLNFQLDIRVLILDDDGCLLSTAINCCGVALVECGISTYDL 177
            .:|....|   |.:..|..:........|:||.|.:|..||...:..:|...:|:::.||...|.
Mouse    92 GDRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVMDAGIPMRDF 156

  Fly   178 ITASTACIYRDHVFLNPSAKVEE 200
            :.|.:|. :.|...|...:.|||
Mouse   157 VCACSAG-FVDGTALADLSHVEE 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mtr3NP_649157.1 RNase_PH 47..274 CDD:295670 52/153 (34%)
Exosc4NP_780608.1 RNase_PH_RRP41 11..237 CDD:206775 52/153 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S936
OMA 1 1.010 - - QHG53663
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001991
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.