DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prp3 and AT3G56790

DIOPT Version :10

Sequence 1:NP_649156.1 Gene:Prp3 / 40172 FlyBaseID:FBgn0036915 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_191238.1 Gene:AT3G56790 / 824846 AraportID:AT3G56790 Length:206 Species:Arabidopsis thaliana


Alignment Length:212 Identity:59/212 - (27%)
Similarity:93/212 - (43%) Gaps:48/212 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 ERSESGTSAQEEAIKYFDDRIALKPTVRTKRTLRFHEPGKFQQLAERMRMKSQLERLQNEISQIA 278
            |||..|:..::.:    ::......|  |.::.||.:..:|::......:.|     ....|||.
plant    27 ERSHEGSKRKDRS----EEENGAART--TNKSSRFEDVARFEKRPYTCSIAS-----DTTSSQIL 80

  Fly   279 RKTGISSATKLAL---IAPKQD----MPDDVPAMEWWDSVILTQDLETVDDASGKISIRQTAITN 336
            .  .:....:||:   :|.||.    :..||...|             :|:....|:: .|.:.|
plant    81 E--AVKRFQELAIDTAVAHKQTKGFFLRVDVLGRE-------------IDEYGHVINL-STLMVN 129

  Fly   337 LIEHPTQ-----MKPPNEPLKPVYLPVFLTKKERKKLRRQNRREAWKEEQEKIRLGLVAPPEPKL 396
            ..:|...     :||| :|.|       |||||.|||:...|....||:|:.||..|..|.:.|:
plant   130 NNKHKKDVFQNILKPP-QPFK-------LTKKEEKKLQTLRRVAKEKEKQKMIRQALFEPQKSKV 186

  Fly   397 RISNLMRVLGSE-AVQD 412
            ::||||:||.|| |.||
plant   187 KLSNLMKVLASELATQD 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prp3NP_649156.1 PRP3 229..441 CDD:462524 55/197 (28%)
DUF1115 464..585 CDD:461943
AT3G56790NP_191238.1 PRP3 <162..203 CDD:462524 18/40 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.