DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prp3 and ppp1r42

DIOPT Version :9

Sequence 1:NP_649156.1 Gene:Prp3 / 40172 FlyBaseID:FBgn0036915 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001002202.1 Gene:ppp1r42 / 431749 ZFINID:ZDB-GENE-040704-43 Length:329 Species:Danio rerio


Alignment Length:179 Identity:38/179 - (21%)
Similarity:72/179 - (40%) Gaps:44/179 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 EWWDSVIL---------------TQDLETVDDASGKISIRQTAITNLIEHPTQMKPPNEPLKPVY 355
            |.||...|               .|:||||.....|:     .:.:|..:|...||.... :.:.
Zfish   161 ELWDLAPLRKMTHLFAADNQLHDIQELETVFSQWFKL-----RLLDLSRNPVCHKPKYRD-RLIT 219

  Fly   356 LPVFLTKKERKKLRRQNRR-----EAWKEEQEKIRLGLVAPPEPKLRISNLMRV-----LGSEAV 410
            :..||...:.|::...:|:     :|.|:.::|...|    .:.||:::|.:..     ||.   
Zfish   220 VCKFLDDLDGKQINELSRQFLINWKASKDAKKKPEDG----KDNKLQVANQLSTSADFHLGP--- 277

  Fly   411 QDPTKMEQHVRDQMAKRQKAHEDANNARKLTSEQ-KSEKKQRKLREDTS 458
            |.|:     ||::.:...|..|:........::| :::.:.|..|.|:|
Zfish   278 QHPS-----VRERSSSLSKPSENEKPGVTFRTDQIQADSRGRGTRGDSS 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prp3NP_649156.1 PRP3 229..441 CDD:285741 33/159 (21%)
DUF1115 466..585 CDD:284060
ppp1r42NP_001002202.1 LRR_RI 29..>207 CDD:238064 11/50 (22%)
LRR_4 30..69 CDD:289563
LRR 1 30..51
leucine-rich repeat 31..52 CDD:275380
LRR_8 51..107 CDD:290566
LRR_4 52..93 CDD:289563
LRR 2 52..73
leucine-rich repeat 53..74 CDD:275380
LRR_4 74..115 CDD:289563
LRR 3 74..95
leucine-rich repeat 75..96 CDD:275380
LRR 4 96..117
leucine-rich repeat 97..118 CDD:275380
LRR 5 118..139
leucine-rich repeat 119..144 CDD:275380
leucine-rich repeat 145..170 CDD:275380 4/8 (50%)
LRR 6 148..169 3/7 (43%)
LRR 7 170..191 4/20 (20%)
leucine-rich repeat 171..196 CDD:275380 5/24 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 268..329 13/62 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2769
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.