DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(Tpl) and Ocln

DIOPT Version :9

Sequence 1:NP_001163477.1 Gene:Su(Tpl) / 40171 FlyBaseID:FBgn0014037 Length:1059 Species:Drosophila melanogaster
Sequence 2:NP_112619.2 Gene:Ocln / 83497 RGDID:620089 Length:523 Species:Rattus norvegicus


Alignment Length:266 Identity:64/266 - (24%)
Similarity:104/266 - (39%) Gaps:69/266 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   693 ASGTSKQRMPPQQSDY-------NSYNSNNAQHVASNSKKRMGSVGPSGGSNGQRQRSASGSNSG 750
            ::||  |.|||..|||       .:|:||                   |..||:|    |..:|.
  Rat   302 SAGT--QDMPPPPSDYAERVDSPMAYSSN-------------------GKVNGKR----SYPDSL 341

  Fly   751 YQQVPP---------PSSNSRSSIQQ--QNQHQKQQVQQKQAPSQQQQQQQQQYHQQAKHPSPSQ 804
            |:. ||         |.:.|....:|  .:.:...:...|:.|::.:.       .:||...|. 
  Rat   342 YKS-PPLVPEVAQEIPLTLSVDDFRQPRYSSNDNLETPSKRTPTKGKA-------GKAKRTDPD- 397

  Fly   805 QLAAAAHAYAHATADTDSSATPRYDF-SQYVPIQTLEVRRRYKTEFESDYDEYRKLLTRVEDVRN 868
                  |.....|...:|......|: .:|.||.:.:.|:.||..|::...||:.||..:::|..
  Rat   398 ------HYETDYTTGGESCDELEEDWLREYPPITSDQQRQLYKRNFDAGLQEYKSLLAELDEVNK 456

  Fly   869 RFQDLSERLESARRCDNGYGDYDHIKRQIVCEYERINNDRTIGEDKERFDY---LHAKLAHIKQL 930
            ....|...|:..|.....|       .....||.|:...:...:.|.:.:|   |.:||:|||::
  Rat   457 ELSRLDRELDDYREESEEY-------MAAADEYNRLKQVKGSADYKSKKNYCKQLKSKLSHIKRM 514

  Fly   931 VMDYDK 936
            |.|||:
  Rat   515 VGDYDR 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(Tpl)NP_001163477.1 ELL 16..460 CDD:287376
Occludin_ELL 836..935 CDD:284669 27/101 (27%)
OclnNP_112619.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
MARVEL 57..263 CDD:366555
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..338 17/60 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 363..408 8/58 (14%)
Occludin_ELL 421..520 CDD:399941 30/105 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339972
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23288
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.